KEGG   Krokinobacter sp. 4H-3-7-5: Krodi_2847Help
Entry
Krodi_2847        CDS       T01484                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
kdi  Krokinobacter sp. 4H-3-7-5
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:kdi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Krodi_2847
   01230 Biosynthesis of amino acids
    Krodi_2847
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Krodi_2847
   00030 Pentose phosphate pathway
    Krodi_2847
   00051 Fructose and mannose metabolism
    Krodi_2847
   00052 Galactose metabolism
    Krodi_2847
  Energy metabolism
   00680 Methane metabolism
    Krodi_2847
Enzymes [BR:kdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Krodi_2847
Protein phosphatases and associated proteins [BR:kdi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Krodi_2847
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3228133..3229119)
Genome map
AA seq 328 aa AA seqDB search
MTKKINKIAVMTSGGDAPGMNAAVRSVVRTCAYHNIDCVGIYRGYDGMIEGDFIPLDARS
VRGIINKGGTFLKSARCQRFRTEDGRQIAHNEMVKAGIDALVVIGGDGTFTGALHFSEEF
DFPVIGIPGTIDNDISGTDRTLGYDTALNTAVEAIDKIRDTAHSHDRLFFVEVMGRDVGH
IALNAGVGAGAEEILIPEENMGIERLVESLQRSKISGKSSSIVVVAEGDKIGKSVFELKD
YVDENMEGYDVRVSVLGHMQRGGSPTCYDRVLASRMGVKAVESLLEGKSNFMVGTIHDMM
ELTPLDEAIKGKSKINKELIRVSEIMTT
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaaaaataaacaaaatcgcagtgatgacctctggaggagatgctccagggatg
aatgctgctgtgcgttctgtagtgcgtacttgtgcctaccataatatagattgtgttggt
atctacagaggttatgatggaatgattgaaggtgactttattcctctcgatgcaagaagc
gtacgggggattattaataaaggaggaacttttttaaagtctgcaagatgtcaacgcttc
aggacagaagatggaaggcagattgcacacaacgagatggtaaaagccggtatagatgca
cttgttgttataggcggtgatggaacgtttactggagcacttcactttagcgaagagttt
gattttcccgtaataggaatcccaggtactatagataatgatatatctggtacagatcgt
acccttggatatgatacggcacttaatacagcagtagaggcgattgacaaaatacgtgat
actgcacactcacacgacagacttttctttgtagaggtaatgggtcgtgatgtaggccat
attgctcttaacgcaggagtaggggcaggagcagaagaaattttaatcccagaagaaaac
atggggatagaaaggctggtagagtctttacaacgttctaaaatatcaggaaaatcctca
agtattgttgttgtagccgaaggtgataaaataggaaagtctgtttttgaactaaaagac
tatgtagacgagaatatggagggatatgatgtacgagtatctgtactaggtcatatgcag
cgtggaggctctcctacgtgttatgatcgtgttcttgcaagtagaatgggagtaaaggct
gtagagtcacttctagagggtaaaagtaattttatggtgggtactattcatgatatgatg
gagcttacaccactagatgaagcaataaaaggtaaaagtaaaattaataaggaattaatc
cgtgtgtcagagataatgaccacataa

DBGET integrated database retrieval system