KEGG   Krokinobacter sp. 4H-3-7-5: Krodi_2862Help
Entry
Krodi_2862        CDS       T01484                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
kdi  Krokinobacter sp. 4H-3-7-5
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:kdi00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:kdi00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3245040..3245969)
Genome map
AA seq 309 aa AA seqDB search
MSELSVNHLLGIKYINEADIDLIFKTADHFKEVINRPIKKVPSLRDITIANLFFENSTRT
KLSFELAEKRLSADVINFSAAASSVKKGETLIDTVNNILSMKVDMVVMRHPNPGAGVFLS
KHIKASIVNAGDGAHEHPTQALLDSYSIRERLGDVAGKNVVIVGDILHSRVALSNIYALK
LQGANVKVCGPKTLLPKYIESLGVEVELDLRKALEWCDVANMLRVQNERMDISYFPSTRE
YTQQYGVNKKLLDSLDKQIVIMHPGPINRGVEITSDVADSEHAIILDQVQNGVAVRMAVM
YLLASKIKQ
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagttgagtgtcaatcatctgttaggaatcaagtacataaacgaggcagatatt
gatcttatttttaaaacggcagatcactttaaggaagtgatcaatcgccctattaaaaag
gtgccatcactgcgtgatattactattgcaaatctcttttttgaaaatagtacacgtaca
aaattgtcttttgagcttgcagaaaaacgtttaagtgcagatgtaattaacttttcggca
gcagcatcatctgtaaagaaaggtgaaacactcattgataccgtaaataatattctatcc
atgaaggtagatatggtagttatgagacaccctaatcctggagctggcgtatttctatca
aaacatatcaaggcaagtattgtaaatgctggagatggtgcacatgagcaccctacacaa
gcattactggatagttattctataagagaacgtctaggtgatgtagcagggaaaaatgtg
gtgattgtaggagatattttacacagccgtgttgcgctatcaaatatctatgcgcttaag
ttgcaaggagcaaacgtaaaagtatgtggtccaaaaacgctattgcctaaatacatagaa
tcactaggagtagaagtagagctagatttacgcaaagcgcttgaatggtgcgacgtggca
aatatgcttcgcgtgcaaaatgagcgaatggatattagttactttccaagcacaagagaa
tacacgcagcaatacggagtgaataagaagttactagattctctagataagcaaattgta
atcatgcacccaggacctataaatcgcggtgtagagattacgagtgacgtagctgactca
gaacatgcaatcatcttagatcaagtacagaacggagttgcagtgagaatggcagtaatg
tatctacttgcatcaaaaatcaaacaataa

DBGET integrated database retrieval system