KEGG   Kribbella flavida: Kfla_0157Help
Entry
Kfla_0157         CDS       T01155                                 

Definition
DNA-formamidopyrimidine glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
kfl  Kribbella flavida
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:kfl03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
164601..165464
Genome map
AA seq 287 aa AA seqDB search
MGVPELPEVESLAGFLRERAVGRAVVRADITAISALKTYDPPISALVGLLIDDVRRHGKF
LDIEAQGVHLVIHLARAGWLRWREQQSTTPVRPGKGPIACRVVLDDESGFDLTEAGTQKK
LAVYVVRDVAEVPGIARLGPDPFTLSAEDFGAILHEAGRVQLKGVLRNQSVIAGIGNAYS
DEILHVARMSPFKPASNLSDDELHVLYTAMQETLRDAVDRSKGLAAQDLKSEKKSGLRVH
GRKGEKCPVCGDVVREVSFADSSLQYCATCQTGGKPLADRRLSKLLK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
gtgggggtgcccgaattgccggaagtggaatcgctggcggggttcctgcgggagcgtgcc
gtcgggcgggcggtcgtgcgcgcggacatcaccgcgatcagcgcgctgaagacctacgac
ccgccgatctccgcgctggtgggcctgctgatcgacgacgttcgccggcacggcaagttc
ctcgacatcgaggcgcagggtgtgcacctggtgatccacctggcccgcgcgggctggttg
cgctggcgcgagcagcagtccaccacgccggtccggccgggcaagggaccgatcgcctgc
cgggtggtgctggacgacgagtccggcttcgacctgaccgaggccggcacccagaagaag
ctcgccgtgtacgtcgttcgcgacgtcgccgaggtgcccggcatcgcgcggctcggcccc
gacccgttcacgctgtcggccgaggacttcggcgcgatcctgcacgaggccggccgggtc
cagctgaagggtgtgctgcgcaaccagtcggtgatcgccgggatcggcaacgcctactcc
gacgagatcctgcacgtggcgaggatgagcccgttcaaaccggcgtcgaacctgtccgac
gacgagctgcacgtgttgtacaccgcgatgcaggagaccctgcgcgacgcggtggaccgc
tcgaagggtctggccgcgcaggacctgaagtcggagaagaagagcggcctgcgggtgcac
ggccgcaagggcgagaagtgcccggtctgcggtgacgtggtccgcgaggtcagcttcgcc
gactcctccctgcagtactgcgcgacctgccagaccggcggcaagccgctggccgaccgc
cggctgtccaagctgctcaagtaa

DBGET integrated database retrieval system