KEGG   Kribbella flavida: Kfla_0409Help
Entry
Kfla_0409         CDS       T01155                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
kfl  Kribbella flavida
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:kfl03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
419950..420549
Genome map
AA seq 199 aa AA seqDB search
MYEGAVQDLIDELGRLPGVGPKSAQRIAFHLLSADETDVRRLAHVLVQVKEKVKFCEICG
NVAEETMCRICRDPRRDLALICVVEEAKDVVAIERTREFRGRYHVLGGAISPIEGIGPDE
LRIRELMQRLASGEVTEIILATDPNLEGEATATYLSRLLRPMGLRVTRLASGLPVGGDLE
YADEVTLGRAFEGRRSIDD
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgaaggggccgtccaggacctcatcgacgagctcggccggctccccggcgtcggt
ccgaagtccgcgcaacgcatcgcgttccacctgttgtccgccgacgagaccgacgttcgg
cggctggcgcacgtcctggtgcaggtgaaggagaaggtcaagttctgcgagatctgcggc
aacgtggccgaggagacgatgtgccggatctgccgcgacccgcgccgcgacctcgcgctg
atctgcgtggtcgaggaggccaaggacgtggtcgcgatcgagcggacccgggagttccgc
ggccggtaccacgtgctcggcggtgcgatctcgccgatcgagggcatcggcccggacgag
ctgcggatccgcgaactgatgcagcgactggccagcggtgaggtgaccgagatcattctc
gctaccgacccgaacctggaaggcgaggcgaccgccacctacctgagccggttgctccgg
cccatggggttgcgcgtcacccgtttggccagtggactacctgtaggcggtgacctcgag
tacgccgacgaggtcacactcggacgggcgtttgaagggcgacgatcgatcgatgactga

DBGET integrated database retrieval system