KEGG   Kribbella flavida: Kfla_0409Help
Entry
Kfla_0409         CDS       T01155                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
kfl  Kribbella flavida
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Kfla_0409
DNA repair and recombination proteins [BR:kfl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Kfla_0409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
419950..420549
Genome map
AA seq 199 aa AA seqDB search
MYEGAVQDLIDELGRLPGVGPKSAQRIAFHLLSADETDVRRLAHVLVQVKEKVKFCEICG
NVAEETMCRICRDPRRDLALICVVEEAKDVVAIERTREFRGRYHVLGGAISPIEGIGPDE
LRIRELMQRLASGEVTEIILATDPNLEGEATATYLSRLLRPMGLRVTRLASGLPVGGDLE
YADEVTLGRAFEGRRSIDD
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgaaggggccgtccaggacctcatcgacgagctcggccggctccccggcgtcggt
ccgaagtccgcgcaacgcatcgcgttccacctgttgtccgccgacgagaccgacgttcgg
cggctggcgcacgtcctggtgcaggtgaaggagaaggtcaagttctgcgagatctgcggc
aacgtggccgaggagacgatgtgccggatctgccgcgacccgcgccgcgacctcgcgctg
atctgcgtggtcgaggaggccaaggacgtggtcgcgatcgagcggacccgggagttccgc
ggccggtaccacgtgctcggcggtgcgatctcgccgatcgagggcatcggcccggacgag
ctgcggatccgcgaactgatgcagcgactggccagcggtgaggtgaccgagatcattctc
gctaccgacccgaacctggaaggcgaggcgaccgccacctacctgagccggttgctccgg
cccatggggttgcgcgtcacccgtttggccagtggactacctgtaggcggtgacctcgag
tacgccgacgaggtcacactcggacgggcgtttgaagggcgacgatcgatcgatgactga

DBGET integrated database retrieval system