KEGG   Kribbella flavida: Kfla_0472Help
Entry
Kfla_0472         CDS       T01155                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
kfl  Kribbella flavida
Pathway
kfl00010  Glycolysis / Gluconeogenesis
kfl00620  Pyruvate metabolism
kfl00640  Propanoate metabolism
kfl00680  Methane metabolism
kfl01100  Metabolic pathways
kfl01110  Biosynthesis of secondary metabolites
kfl01120  Microbial metabolism in diverse environments
kfl01130  Biosynthesis of antibiotics
kfl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kfla_0472
   00620 Pyruvate metabolism
    Kfla_0472
   00640 Propanoate metabolism
    Kfla_0472
  Energy metabolism
   00680 Methane metabolism
    Kfla_0472
Enzymes [BR:kfl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Kfla_0472
Lipid biosynthesis proteins [BR:kfl01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Kfla_0472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N MlrC_C Ntox5 FIST
Motif
Other DBs
NCBI-ProteinID: ADB29595
UniProt: D2PVT8
Position
complement(481495..483474)
Genome map
AA seq 659 aa AA seqDB search
MTSSESPHSEALSNLMHEERRFEPPAELAAHANVQADAYDTAAADLEGFWAAQAKRLTWA
VEPTETLDWSNPPFAKWYADGKLNAAYNCVDRHVENGLGDKVAYYFEGEPGDTREITYAQ
LKDEVSQAANALQELGVQAGDVVAIYMPMIPETVVAMLACARIGAPHTVIFGGFSADALK
GRILDCDARVVITSDGGYRRGAPAALKPAVDAALADCPDVRNVLVVQRTGQETAMVEGRD
LWWQDFVGQQSTEHTPEAFDAEHPLYVMYTSGSTGKPKGILHTTGGYLVGTAYTQWAVFD
LKPDTDVYWTAADIGWVTGHSYIVYGALANATTSVLYEGTPDTPHQGRWWEIVQKYKVSI
LYCAPTAIRTFMKWGKEIPEKFDLSSLRVIGSVGEPINPEAYIWYRENIGGNQAPVVDTW
WQTETGMHMISPLPGVTAGKPGAAMRAIPGVSVDVVDDAGTPVPNGSGGYLVITKPWPAM
LRTLWGDDQRFKDTYWSRFPGMYFAGDGAKKDEDGDLWLLGRVDDVMNVSGHRLSTTEIE
SALVSHPKVAEAAVVGASDPTTGQAIAAFVILRSEAGDGGPDVVQELRTHVAKEIGPIAK
PRQIMVVAELPKTRSGKIMRRLLRDVAENREVGDVTTLADSTVMDLIKSNLESGKTDED
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagttccgagtcaccccattccgaagcgctgtcgaacctgatgcacgaggaacgc
cggttcgagccgccggccgagctcgccgcgcacgccaacgtccaggccgacgcctacgac
accgccgcggccgacctggaggggttctgggccgcgcaggccaagcggctgacctgggcg
gtcgaaccgaccgagacgctggactggagcaacccgccgttcgccaagtggtacgccgac
ggcaagctcaacgcggcgtacaactgcgtcgaccggcacgtcgagaacgggctcggcgac
aaggtcgcctactacttcgagggcgagcccggcgacacccgcgagatcacctacgcccag
ctcaaggacgaggtcagccaggcggcgaacgcgctgcaggagctcggcgtccaggccggt
gacgtggtcgcgatctacatgccgatgatcccggagaccgtggtcgcgatgctcgcctgc
gcccggatcggcgccccgcacacggtgatcttcggcggtttctccgcggacgcgctcaag
ggccggatcctggactgcgacgcccgcgtcgtgatcacctcagacggcggttaccgccgg
ggcgccccggccgcgctgaagccggccgtcgacgccgcgctggccgactgcccggacgtg
cgcaacgtgctcgtggtgcagcgcaccggccaggagaccgcgatggtggagggccgcgac
ctgtggtggcaggacttcgtcggccagcagtcgaccgagcacacgccggaggcgttcgac
gccgagcacccgctgtacgtgatgtacacgtccggcagcaccggcaagcccaagggcatc
ctgcacacgaccggcggctacctggtggggacggcgtacacgcagtgggcggtgttcgac
ctcaagcccgacaccgacgtctactggaccgccgccgacatcggctgggtcaccggccac
agctacatcgtctacggcgcgctcgcgaacgcgaccacctcggtgctctacgagggcacc
ccggacaccccccaccagggccgctggtgggagatcgtgcagaagtacaaggtctcgatc
ctgtactgcgcgccgaccgcgatccggaccttcatgaagtggggcaaggagatcccggag
aagttcgacctgtcctcgctgcgggtgatcgggtcggtcggcgagccgatcaacccggag
gcctacatctggtaccgggagaacatcggcggcaaccaggcgccggtggtcgacacctgg
tggcagaccgagaccggcatgcacatgatctccccgctgcccggtgtcaccgcgggcaag
ccgggtgcggcgatgcgggcgatcccgggcgtcagcgtcgacgtggtcgacgacgccggc
accccggtgccgaacggctccggcggctacctggtgatcaccaagccctggccggccatg
ctgcgcacgctgtggggcgacgaccagcggttcaaggacacctactggtcgcgcttcccc
ggcatgtacttcgccggcgacggcgcgaagaaggacgaggacggcgacctgtggctgctc
ggccgggtggacgacgtgatgaacgtgtccggccaccggctgtccaccaccgagatcgag
tctgcgctggtctcgcacccgaaggtcgccgaggcggccgtggtcggcgcctccgacccg
accaccgggcaggcgatcgcggcgttcgtgatcctgcgctcggaggccggtgacggcggt
ccggacgtggtccaggagctgcgcacccacgtcgccaaggagatcggcccgatcgccaag
ccgcgccagatcatggtcgtcgccgaactgccgaagacccggtcgggcaagatcatgcgc
cggctgctgcgcgacgtcgccgagaaccgcgaggtcggcgacgtcaccacgctggccgac
tcgaccgtgatggacctgatcaagtccaacctggagtccggcaagaccgacgaggactga

DBGET integrated database retrieval system