KEGG   Kribbella flavida: Kfla_0722Help
Entry
Kfla_0722         CDS       T01155                                 

Definition
malate synthase A (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
kfl  Kribbella flavida
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Kfla_0722
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Kfla_0722
   00630 Glyoxylate and dicarboxylate metabolism
    Kfla_0722
Enzymes [BR:kfl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Kfla_0722
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
745048..746619
Genome map
AA seq 523 aa AA seqDB search
MAVEVTGPMHERYDEILSAQALDLIGLLHRELNPRRRELLDRRRARVEQIAAGGTLGFLP
ETAAVREDPDWRVAPPAPGLVDRRVEITGPTDRKMTVNALNSGAKVWLADQEDANTPRWE
NVIGGQLNLLDAVTRKIDFTSEAGKSYALRPDEELATIVVRPRGLHLPEKHLLVDGERTS
GALVDFALYLSACGQLQLDRGQGPYFYLPKLESHLEARLWNDAFLLAQDRLGIPRGTIRA
TVLIETFPAAFEMEEILYELREHSAGLNAGRWDFMFSVIKTYRTRGRDFQLPDRNSVTMT
VPFMRAYTELLVRTCHRRGAHAIGGMAAFIPSKDPVVNEQAFAKVEADKRREAGDGFDGS
WVAHPGMVETCRAVFDEVLGDRPNQLDRLREDVSVTADQLLDVAATPGEVTEAGLRNNVS
VAIQYLAAWLRGTGAVGIFNLMEDAATAEISRSQIWQWRRNGVVLDTGAVVTTELVTTIA
DEEIAELTDDPTAYADARQTFLAVATADDYVDFLTLPAYERMP
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
gtggcagtcgaggtcaccggaccgatgcacgagcggtacgacgagatcctcagcgctcag
gcgctcgacctgatcggcctgctgcaccgcgagctgaacccgcgccggcgggagctgctc
gaccgccgccgggcccgcgtcgagcagatcgccgccggtggcacgctcggcttcctgccc
gagacggccgcggttcgcgaggaccccgactggcgggtcgcgccgcccgcgccggggctg
gtcgaccgccgggtcgagatcaccggcccgaccgaccgcaagatgaccgtgaacgcgctg
aactccggtgccaaggtgtggctcgccgaccaggaggacgcgaacaccccgcggtgggag
aacgtgatcggcggccagctcaacctgctcgacgcggtcacccgcaagatcgacttcacc
agcgaggcgggcaagtcgtacgcgctacggccggacgaggagctggccaccatcgtggtt
cgcccgcgcggcctgcacctgccggagaagcacctgctggtcgacggcgagcggacgtcc
ggtgcgctggtcgacttcgcgctctacctgagcgcgtgcgggcagctgcagctcgaccgc
ggccagggcccgtacttctacctgccgaagctggagtcgcacctggaggcccggctctgg
aacgacgcgttcctgctcgcgcaggaccggctcggcatcccgcgcggcacgatccgggcg
acggtgctgatcgagacgttcccggcggcgttcgagatggaggagatcctctacgagctg
cgcgagcactccgccggcctgaacgcgggccgctgggacttcatgttcagcgtgatcaag
acctaccggacccgcggccgcgacttccagctgccggaccggaactcggtgacgatgacc
gtgccgttcatgcgggcctacaccgagctgctggtccggacctgccaccggcgcggcgcg
cacgcgatcggcgggatggcggcgttcatcccgagcaaggacccggtggtcaacgagcag
gcgttcgccaaggtcgaggcggacaagcggcgcgaggccggcgacgggttcgacggctcc
tgggtggcgcaccccggcatggtcgagacctgtcgcgcggtcttcgacgaggtgctcggc
gaccggccgaaccagctcgaccgcctgcgcgaggacgtcagcgtcaccgccgaccagttg
ctcgacgtcgccgcgacccccggcgaggtgaccgaggccgggctgcgcaacaacgtcagc
gtggcgatccagtacctcgccgcctggctgcgcggtaccggcgcggtcggcatcttcaac
ctgatggaggacgccgccaccgccgagatctcgcgctcccagatctggcagtggcgccgc
aacggcgtcgtgctggacaccggcgcggtggtgaccactgagctggtcaccaccatcgcc
gacgaggagatcgccgagctcaccgacgaccccacggcgtacgccgacgcccgccagacc
ttcctcgccgtcgccaccgccgacgactacgtcgacttcctcaccctgcccgcctacgaa
cggatgccgtag

DBGET integrated database retrieval system