KEGG   Kribbella flavida: Kfla_0909Help
Entry
Kfla_0909         CDS       T01155                                 

Definition
phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
kfl  Kribbella flavida
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Kfla_0909
Enzymes [BR:kfl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Kfla_0909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
970444..972822
Genome map
AA seq 792 aa AA seqDB search
MQQIDATPLSDEELQGLDAYWRAANYLSVGQIYLLANPLLKEPLGPDHIKPRLLGHWGTT
PGLNLIYAHLNRVIRQRERDLMYVIGPGHGGPAIVANTWLEGSWTATYPNTTQDEPGMAR
LFKQFSFPGGIPSHVAPEVPGSINEGGELGYSLSHAYGAAADNPDLVVACVIGDGEAETG
PLATSWHCNKFVDPRRDGAVLPILHLNGYKIANPAVLARIGDEELTALLRGLGHEPYLVE
GSDPATVHQALAATLDRCLDRIDEIQLEARTAETPPGRSAWPMIVLKTPKGWTGPHTVDG
EPVEDTWRSHQVPLSGVRSNDDHLRQLEDWLRSYRPEELFDADGRPVERLLELAPPPSLR
MGSSPHANGGVLTRDLELPDPADHAVPVKAPGAEDGEPTKVFGQYLRDAFVLNEPHRNLR
LFGPDETESNRLNAVYEVTGKAWVAERRDTDRNLAIDGRVLEMLSEHTCQGWLEGYLLTG
RHGLFSSYEAFVHIVDSMVNQHAKWLKSINRLDWRRPVPSLNYLLTSHVWRQDHNGFSHQ
DPGFIDHVVNKKAEVVRVYLPPDANTLLSTMDHCLRTRNYINVVVAGKQPQPNWLDWESA
ALHCARGIGVWDFASNDDGEPDVVMACAGDVPTLETMAAVDLLREHLPQLKVRVVNVVDL
MRLQDATEHPHGLTDPEFDALFTTDKPVIFAYHGYPWLIHRLTYRRRGHANLHVRGYIEE
GTTTTPFDMVVLNNLDRYHLAMDVIDRVPSLGSRAASVRQHFSDQRVRHRAHTTTYGEDL
PEVRDWRWGRPR
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcagatcgacgccaccccgttgagcgacgaggagttgcagggtctcgacgcgtac
tggcgagccgcgaactacctgtccgtgggacagatctacctgctcgccaacccgctgctg
aaggagccgctggggcccgaccacatcaagccgcggctgctcgggcactggggcacgacg
ccggggctcaacctgatctacgcccacctcaaccgggtgatccggcagcgtgagcgcgac
ctgatgtacgtgatcgggccgggccacggcggtccggcgatcgtcgccaacacctggctc
gagggcagctggaccgcgacgtacccgaacaccacccaggacgagccgggcatggcgcgg
ctgttcaagcagttctccttccccggtggcattcccagccacgtcgctcccgaggtgccg
ggttcgatcaacgagggcggcgagctcggctactcgctcagccacgcctacggcgcggcg
gcggacaaccccgacctggtggtcgcctgcgtgatcggtgacggcgaggccgagaccggc
ccgctggcgacgtcgtggcactgcaacaagttcgtcgatccgcgtcgcgacggcgcggtg
ctgccgatcctgcacctcaacggctacaagatcgccaacccggcggtgctggcccggatc
ggcgacgaggagctcaccgcgttgctgcgcggcctcggccacgagccgtacctggtcgag
ggctccgacccggcgaccgtgcatcaggcgctggccgcgacgctggaccgctgcctggac
cggatcgacgagatccagctggaggcgcggaccgccgagacaccgccgggccggtcggcc
tggccgatgatcgtgctcaagacgccgaagggctggaccggtccgcacacggtggacggc
gagccggtcgaggacacctggcggtcccaccaggtcccgctgtccggcgtccggtcgaac
gacgaccacctgcgccagctggaggactggctgcgcagctaccggccggaagagctgttc
gacgccgacggccggccggtggaacggctgctggagctggccccgcccccgtcgctgcgg
atgggttccagcccgcacgccaacggcggcgtcctcactcgggacctggaactgcccgac
cccgccgaccacgccgtaccggtgaaggcgccgggggccgaggacggggaaccgaccaag
gtgttcgggcagtacctgcgggacgcgttcgtgctcaacgaaccgcaccgcaacctgcgg
ctgttcggcccggacgagaccgagtcgaaccggctgaacgcggtgtacgaggtgaccggc
aaggcctgggtggcggagcggcgggacaccgaccggaacctggcgatcgacggccgcgtg
ctggagatgctcagcgagcacacctgtcaaggctggttggaggggtacctgctgaccggg
cggcacgggctgttctcgtcgtacgaggcgttcgtgcacatcgtcgactcgatggtgaac
cagcacgcgaagtggctgaagtcgatcaaccggctcgactggcgccggccggtcccgtcg
ctcaactacctgctcacctcgcacgtgtggcggcaggaccacaacggcttctcgcaccag
gatcccggcttcatcgaccacgtggtgaacaagaaggccgaggtggtccgggtctacctg
ccgccggacgccaacacgctgctgtccacgatggaccactgcctgcggacccggaactac
atcaacgtcgttgtcgccggcaagcagccgcagccgaactggctggactgggagtcggcc
gcgctgcactgcgcccgcgggatcggcgtctgggacttcgccagcaacgacgacggcgag
cccgacgtggtgatggcctgcgccggcgacgtgccgacactggagacgatggccgcggtc
gatctgctgcgcgagcacctgccgcagctgaaggtccgggtggtgaacgtggtcgacctg
atgcgcctgcaggacgcgaccgagcacccgcacgggctgaccgatccggagttcgacgcg
ctgttcaccaccgacaagccggtgatcttcgcgtaccacggctacccgtggctgattcac
cggctgacctaccggcggcgcgggcacgccaacctgcacgtgcgcgggtacatcgaggag
ggcaccaccaccacgccgttcgacatggtggtgctgaacaacctcgaccgctaccacctg
gcgatggacgtgatcgaccgggtgccgtcgctgggcagccgcgcggcctcggtccggcag
cacttctccgaccagcgtgtccggcaccgcgctcataccaccacgtacggcgaggacctg
cccgaggtgcgcgactggcgctggggccgcccccgctga

DBGET integrated database retrieval system