KEGG   Kribbella flavida: Kfla_0946Help
Entry
Kfla_0946         CDS       T01155                                 

Definition
glycoside hydrolase family 3 domain-containing protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
kfl  Kribbella flavida
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:kfl00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:kfl00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1011083..1012327
Genome map
AA seq 414 aa AA seqDB search
MTSMKTFPGVAVVAATALLLAGCSSGGSPTAGPSTVPSSTVPLSPSDPPPATDTPSRSPS
QTPSTPPNVGCLEQKLAGLTLRERAAQLIMTGIASTGMTSAERSVVRERKPGGVLLMGSG
GSLDHTRSEMAAVRSAATIDGIQPFVAADQEGGKIQRLKGSGFDRIPAATEQATWTPQKL
TAEATTWGRQLKRAGVNVDLAPVADVVPESLGDDNAPIGALDRGYGSTPDAVGPHVAAFI
RGMDAAGVMTSVKHFPGLGRVRGNTDFSAGVVDTVTVRGDADLGPFAAGIEAGSDMVMIS
TVTYTEIDPDNRAVFSPIVIQGMLRRELRFGGVVITDDVGAAAEVASVPAGERATRFIGA
GGDVVITARAGLTGTMIDAVVRKAQRDKAFAAQVEASVRRVLVLKQNRGLMDCG
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcgatgaagaccttcccaggcgtagccgttgtcgccgccacagcactgcttctc
gccggttgcagcagcggtggctcgccgacggccggtcccagcaccgttccctcctccacc
gtgccgctgtcgccgtcggacccgccgccggccacggacacgccgagccggtcgcccagt
cagactccgagtacgccgccgaacgtgggctgcctggagcagaagctggccggcctgacg
ctgcgtgagcgagcggctcagctgatcatgaccggcatcgcctccaccggcatgacctct
gccgagcggtccgtggtccgtgagcgcaagccaggcggtgtcctgctgatgggcagcggc
ggcagcctcgaccacacccgctccgagatggccgccgtcaggtccgcggccaccatcgac
gggatccagccgttcgtggccgccgaccaggagggtggcaagatccagcgtctgaagggc
tccggcttcgaccgcatcccggccgcgaccgagcaggccacctggaccccgcagaagctc
accgcggaggcgaccacctggggccggcagctcaagcgcgccggggtcaacgtcgacctg
gcgccggtcgcggacgtcgtaccggagtcgttgggcgacgacaacgcgccgatcggggcg
ctcgaccgcggctacggcagtacgccggacgccgtcggaccgcacgtcgccgcgttcatc
cgcggcatggacgcggccggggtgatgacctcggtcaagcacttcccgggactgggccgg
gtgcggggcaacaccgacttctccgccggggtggtggacaccgtcaccgtgcgcggcgat
gccgacctcgggccgttcgcggccgggatcgaggccggcagcgacatggtgatgatctcc
accgtcacctacaccgagatcgatcccgacaaccgcgcggtgttctcaccgatcgtcatc
cagggcatgctgcgccgcgagctgcggttcggcggcgtggtgatcaccgacgacgtcggc
gcggcggccgaggtggcctcggtgccggcgggggagcgcgccacccggttcatcggcgcc
ggtggtgacgtggtgatcaccgccagggcgggactcaccggcacgatgatcgacgcggtg
gtccgcaaggcccagcgggacaaggcgttcgcggcgcaggtggaggccagcgtgcgccgc
gtgctcgtgctcaagcagaaccgtggcctgatggactgcggatga

DBGET integrated database retrieval system