KEGG   Kribbella flavida: Kfla_1009Help
Entry
Kfla_1009         CDS       T01155                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
kfl  Kribbella flavida
Pathway
kfl00010  Glycolysis / Gluconeogenesis
kfl00260  Glycine, serine and threonine metabolism
kfl00680  Methane metabolism
kfl01100  Metabolic pathways
kfl01110  Biosynthesis of secondary metabolites
kfl01120  Microbial metabolism in diverse environments
kfl01130  Biosynthesis of antibiotics
kfl01200  Carbon metabolism
kfl01230  Biosynthesis of amino acids
Module
kfl_M00002  Glycolysis, core module involving three-carbon compounds
kfl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kfla_1009
  Energy metabolism
   00680 Methane metabolism
    Kfla_1009
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Kfla_1009
Enzymes [BR:kfl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Kfla_1009
Membrane trafficking [BR:kfl04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Kfla_1009
Exosome [BR:kfl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Kfla_1009
  Exosomal proteins of melanoma cells
   Kfla_1009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADB30114
UniProt: D2Q1C6
Position
1068673..1069419
Genome map
AA seq 248 aa AA seqDB search
MTYRLILLRHGHSDWNAKNLFTGWVDVDLNAQGVEEAHRGGQLLLERDLLPDVLHTSLLR
RAIRTANIALEEAGRQWIDVRRSWRLNERHYGALQGKDKKQTLEELGEEQFMLFRRSYDT
PPPPIERGSEFDQAGDPRYAALPSELLPATECLKDVVVRMLPYWYDAIVPDLRDGKTVLV
TAHGNSLRALVKHLDQLDEKTVVGLNIPTGVPLYYELDDDFNPVTPGGEYLDPAAAQAAI
EAVKNQGR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgacctatcgcctgatcctgctccgccacggccacagcgactggaacgccaagaacctg
ttcaccggctgggtcgacgtcgacctgaacgcccagggcgtcgaggaggcgcaccgcggc
ggccagctgctgctggagcgcgacctgctgccggacgtgctgcacacctccctgctgcgc
cgtgccatccgcaccgcgaacatcgccctcgaggaggccgggcgccagtggatcgacgtt
cgccggtcctggcggctgaacgagcggcactacggcgctctgcagggcaaggacaagaag
cagacgctggaggagcttggtgaggagcagttcatgctgttccgccgctcctacgacacc
ccgccgccgccgatcgagcgcggttcggagttcgaccaggccggcgacccgcggtacgcc
gccctgcccagcgagttgctgccggcaacggagtgcctgaaggacgtcgtggtccggatg
ctgccgtactggtacgacgcgatcgtgccggacctgcgcgacggcaagaccgtgctggtc
accgcgcacggcaactcgctgcgcgcgctggtcaagcacctggaccagctcgacgagaag
accgtcgtcggcctgaacatcccgaccggcgtcccgctgtactacgagctggacgacgac
ttcaacccggtcacccccggcggcgagtacctcgacccggccgccgcccaggccgccatc
gaggccgtcaagaaccaaggccgctga

DBGET integrated database retrieval system