KEGG   Kribbella flavida: Kfla_1009Help
Entry
Kfla_1009         CDS       T01155                                 

Definition
phosphoglycerate mutase 1 family (EC:5.4.2.4)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
kfl  Kribbella flavida
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:kfl01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:kfl01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:kfl00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:kfl00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:kfl00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1068673..1069419
Genome map
AA seq 248 aa AA seqDB search
MTYRLILLRHGHSDWNAKNLFTGWVDVDLNAQGVEEAHRGGQLLLERDLLPDVLHTSLLR
RAIRTANIALEEAGRQWIDVRRSWRLNERHYGALQGKDKKQTLEELGEEQFMLFRRSYDT
PPPPIERGSEFDQAGDPRYAALPSELLPATECLKDVVVRMLPYWYDAIVPDLRDGKTVLV
TAHGNSLRALVKHLDQLDEKTVVGLNIPTGVPLYYELDDDFNPVTPGGEYLDPAAAQAAI
EAVKNQGR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgacctatcgcctgatcctgctccgccacggccacagcgactggaacgccaagaacctg
ttcaccggctgggtcgacgtcgacctgaacgcccagggcgtcgaggaggcgcaccgcggc
ggccagctgctgctggagcgcgacctgctgccggacgtgctgcacacctccctgctgcgc
cgtgccatccgcaccgcgaacatcgccctcgaggaggccgggcgccagtggatcgacgtt
cgccggtcctggcggctgaacgagcggcactacggcgctctgcagggcaaggacaagaag
cagacgctggaggagcttggtgaggagcagttcatgctgttccgccgctcctacgacacc
ccgccgccgccgatcgagcgcggttcggagttcgaccaggccggcgacccgcggtacgcc
gccctgcccagcgagttgctgccggcaacggagtgcctgaaggacgtcgtggtccggatg
ctgccgtactggtacgacgcgatcgtgccggacctgcgcgacggcaagaccgtgctggtc
accgcgcacggcaactcgctgcgcgcgctggtcaagcacctggaccagctcgacgagaag
accgtcgtcggcctgaacatcccgaccggcgtcccgctgtactacgagctggacgacgac
ttcaacccggtcacccccggcggcgagtacctcgacccggccgccgcccaggccgccatc
gaggccgtcaagaaccaaggccgctga

DBGET integrated database retrieval system