KEGG   Kribbella flavida: Kfla_1009Help
Entry
Kfla_1009         CDS       T01155                                 

Definition
phosphoglycerate mutase 1 family (EC:5.4.2.4)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
kfl  Kribbella flavida
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Kfla_1009
   01230 Biosynthesis of amino acids
    Kfla_1009
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kfla_1009
  Energy metabolism
   00680 Methane metabolism
    Kfla_1009
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Kfla_1009
Enzymes [BR:kfl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Kfla_1009
Exosome [BR:kfl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Kfla_1009
  Exosomal proteins of melanoma cells
   Kfla_1009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1068673..1069419
Genome map
AA seq 248 aa AA seqDB search
MTYRLILLRHGHSDWNAKNLFTGWVDVDLNAQGVEEAHRGGQLLLERDLLPDVLHTSLLR
RAIRTANIALEEAGRQWIDVRRSWRLNERHYGALQGKDKKQTLEELGEEQFMLFRRSYDT
PPPPIERGSEFDQAGDPRYAALPSELLPATECLKDVVVRMLPYWYDAIVPDLRDGKTVLV
TAHGNSLRALVKHLDQLDEKTVVGLNIPTGVPLYYELDDDFNPVTPGGEYLDPAAAQAAI
EAVKNQGR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgacctatcgcctgatcctgctccgccacggccacagcgactggaacgccaagaacctg
ttcaccggctgggtcgacgtcgacctgaacgcccagggcgtcgaggaggcgcaccgcggc
ggccagctgctgctggagcgcgacctgctgccggacgtgctgcacacctccctgctgcgc
cgtgccatccgcaccgcgaacatcgccctcgaggaggccgggcgccagtggatcgacgtt
cgccggtcctggcggctgaacgagcggcactacggcgctctgcagggcaaggacaagaag
cagacgctggaggagcttggtgaggagcagttcatgctgttccgccgctcctacgacacc
ccgccgccgccgatcgagcgcggttcggagttcgaccaggccggcgacccgcggtacgcc
gccctgcccagcgagttgctgccggcaacggagtgcctgaaggacgtcgtggtccggatg
ctgccgtactggtacgacgcgatcgtgccggacctgcgcgacggcaagaccgtgctggtc
accgcgcacggcaactcgctgcgcgcgctggtcaagcacctggaccagctcgacgagaag
accgtcgtcggcctgaacatcccgaccggcgtcccgctgtactacgagctggacgacgac
ttcaacccggtcacccccggcggcgagtacctcgacccggccgccgcccaggccgccatc
gaggccgtcaagaaccaaggccgctga

DBGET integrated database retrieval system