KEGG   Kribbella flavida: Kfla_1230Help
Entry
Kfla_1230         CDS       T01155                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
kfl  Kribbella flavida
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Kfla_1230
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kfla_1230
  Lipid metabolism
   00071 Fatty acid degradation
    Kfla_1230
  Amino acid metabolism
   00350 Tyrosine metabolism
    Kfla_1230
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Kfla_1230
   00626 Naphthalene degradation
    Kfla_1230
Enzymes [BR:kfl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Kfla_1230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1292596..1293618
Genome map
AA seq 340 aa AA seqDB search
MRAVVVERFGVVPEVREVGRPGVPVGGVVVRVQATGLCRSDWHGWQGHDSDIVLPHVPGH
ELAGTIAEVGDGVTGWQVGDRVTTPFICACGTCEQCLAGNHQVCPNQLQPGFNYWGSFAE
YVAVPFAEVNLVRLPDELEFETAAGLGCRFATSFRAVRQVGKVVAGEDVVVFGCGGVGLS
AVMIAAALDARVIAVDTNPGALELARAYGAAATVQAGPRAVEEIRELTGGGAQVTMDALG
SNEIVQQALLALRPRGRHLQVGLLPAGVQLDVSRLIGQELEWLGSHGMAAHAYPEMLELV
ASGVLKPADLIARTISLDEVPAALDALTAGTPAGVTVIRP
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcgggctgtggtggtggagcggttcggggtggtgccggaggttcgggaggtggggcgg
ccgggggtgcctgtgggtggggtggtcgtgcgggtccaggcgaccgggttgtgccggagt
gactggcacgggtggcaggggcacgactcggacatcgtgttgccgcatgtgccggggcac
gagttggccgggacgatcgcggaggtgggcgacggcgtcaccgggtggcaggtcggggac
cgggtgacgacgccgttcatctgtgcgtgtgggacgtgcgagcagtgcctcgcgggcaac
caccaggtctgcccgaaccagctgcagccggggttcaactactggggttcgttcgcggag
tacgtcgcggtgccgtttgccgaggtgaacctggttcggctgccggacgagctggagttc
gagacggcggcggggctggggtgcaggttcgcgacctcgttccgggcggtgcggcaggtc
ggcaaggtggtggcgggcgaggacgtcgtggtgttcgggtgcggcggtgtcgggctgtcc
gcggtgatgatcgccgccgcgctggacgcccgggtgatcgcggtcgacacgaatcccggc
gcgctcgaactggcgcgggcgtacggcgcggccgcgaccgtgcaggcgggtccgcgggca
gtcgaggagatccgcgagctgaccggtggcggggcgcaggtgacgatggacgccctcggg
tccaacgagatcgtccagcaggccctgctcgcgttgcggccgcgcgggcggcacctgcag
gtcggtctgctgccggccggcgtgcagctcgacgtgtcgcggctgatcggccaggagctg
gaatggctggggagccacgggatggctgcccacgcctatccggagatgctcgagctggtc
gcgtccggcgtactgaagccggccgacctgatcgcccggacgatctcgctcgacgaggtc
ccggccgccttggacgcgctgacggccgggactcctgccggtgtgacggttatccggccc
tga

DBGET integrated database retrieval system