KEGG   Kribbella flavida: Kfla_1272Help
Entry
Kfla_1272         CDS       T01155                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
kfl  Kribbella flavida
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Kfla_1272
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Kfla_1272
   00640 Propanoate metabolism
    Kfla_1272
   00660 C5-Branched dibasic acid metabolism
    Kfla_1272
Enzymes [BR:kfl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Kfla_1272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1329861..1331033
Genome map
AA seq 390 aa AA seqDB search
MDLMEYQAKTVFAKHGVRTTVGEVVTTPEQARAAAEKIGGTVVVKAQVKTGGRGKAGGVK
LASSPDEAEQKAREILGLDIKGHVVKTLNIVPAAAIGEEYYFSFLIDRANRNYLCIASAA
GGMEIEEVAHTNPDAVAKISIDPATGVDEALAREIAEQAGYPADVLDAAAVEIAKLYQVF
IAEDASLVEVNPLVKLEDGNVEALDGKVTLDENADFRHPDHAEFEDSSAEDPLEAAAKAK
GLNYVKLDGSVGIIGNGAGLVMSTLDVVAYAGEQFGGVKPANFLDIGGGASAEVMANGLE
IIISDPQVESVFVNVFGGITACDAVANGIVQAFELLAGRGEAVNKPLVVRLDGNNAEEGR
RILDEAGLAGLERVDTMDGAAKRAAELAAK
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
gtggatctgatggaataccaggcgaagacggtcttcgccaagcacggcgtgcggacgacg
gtcggcgaggtcgtcaccacgccggaacaagcccgcgccgccgccgagaagatcggcggc
accgtggtggtcaaggcccaggtgaagaccggcggccgcggcaaggccggcggcgtcaag
ctggcctcctcgcccgacgaggcggagcagaaggcgcgcgagatcctcggcctggacatc
aagggccacgtcgtcaagacgctgaacatcgtgccggccgccgcgatcggcgaggagtac
tacttctcgttcctgatcgaccgggccaaccgcaactacctgtgcatcgcctccgccgcc
ggcggcatggagatcgaggaggtcgcgcacaccaacccggacgcggtcgccaagatctcg
atcgacccggccaccggtgtcgacgaggccctggctcgcgagatcgccgagcaggccggc
tacccggccgacgtgctggacgccgccgcggtcgagatcgccaagctgtaccaggtcttc
atcgccgaggacgcctcgctggtcgaggtgaacccgctggtcaagctcgaggacggcaac
gtcgaggcgctggacggcaaggtcaccctggacgagaacgccgacttccggcacccggac
cacgccgagttcgaggacagctccgccgaggacccgctggaggccgcggccaaggccaag
ggcctgaactacgtgaagctcgacggctccgtcggcatcatcggcaacggcgcggggctg
gtcatgtcgacgctcgacgtggtcgcgtacgccggtgagcagttcggcggcgtcaagccg
gccaacttcctcgacatcggcggcggcgcgtccgccgaggtgatggcgaacgggctggag
atcatcatctccgacccgcaggtggaaagcgtgttcgtcaacgtgttcggcggcatcacc
gcctgcgacgcggtcgcgaacggcatcgtccaggccttcgagctgctggccggccgcggt
gaggccgtgaacaagccgctggtcgtccggctggacggcaacaacgccgaggagggccgc
cgcatcctcgacgaggccgggctggccggtctggagcgggtcgacacgatggacggcgcc
gccaagcgggccgccgagctggctgcgaagtaa

DBGET integrated database retrieval system