KEGG   Kribbella flavida: Kfla_1352Help
Entry
Kfla_1352         CDS       T01155                                 

Definition
pyrimidine-nucleoside phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
kfl  Kribbella flavida
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Kfla_1352
Enzymes [BR:kfl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Kfla_1352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1421185..1422462
Genome map
AA seq 425 aa AA seqDB search
MTFDAVDVIRTKRDRGELSDGQIDWVIDAYTRGDVADEQMSSLAMAILLNGMTRREIARW
TAAMIASGERMNFAELSRPTADKHSTGGVGDKITLPLAPLVAACGVAVPQLSGRGLGHTG
GTLDKLESIPGWRAALSNDELMRQLDDVGAVICAAGDGLAPADKKLYALRDVTGTVEAIP
LIASSIMSKKIAEGTGALVLDVKVGTGAFMKDLADARELAETMVALGTDAGVRTVALLTD
MSTPLGLTAGNALEVRESLEVLAGGGPADVVELTVALAAEMLAAAGVTDVDPAEKLKDGT
AMDVWRRMIAAQGGDPDAELPVAPEQHVVKAETSGVLSRLDALAVGVAAWRLGAGRARKE
DPVSPVAGVELHAKPGDQVTAGQPLLTLHADDPSRFERALESLADAVEIGDAYDATPLVI
DRITA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
gtgactttcgacgccgtcgacgtgatccgtaccaagcgggaccgaggtgagttgagcgac
ggccagatcgactgggtgatcgacgcctacacccgcggcgacgtcgccgacgagcagatg
tcgtcgctggcgatggcgatcctgctgaacggcatgacccgccgggagatcgcccgctgg
accgccgcgatgatcgcctcgggcgagcggatgaacttcgccgaactgtcccggccgacc
gccgacaagcactccaccggcggcgtcggcgacaagatcaccctgccgctggccccgctg
gtggcggcctgcggagtcgccgtcccgcagctgtccggccgcggtctcggtcacaccggc
ggcacgctggacaaactggagtcgattcccggctggcgcgccgcgctgtcgaacgacgag
ctgatgcgccagctcgacgacgtcggcgcggtgatctgcgcggccggcgacggactggcg
ccggcggacaagaagctgtacgcgctgcgcgacgtgaccgggacggtcgaggcgatcccg
ctgatcgccagctcgatcatgagcaagaagatcgccgagggcaccggcgcgctggtgctg
gacgtgaaggtcgggaccggcgcgttcatgaaggacctggccgacgcccgcgagctggcc
gagacaatggttgccctgggcaccgacgcgggggtgcgcacggtcgcgctgctgaccgac
atgtcgacaccgctcgggctcaccgccggcaacgcgctggaggtccgggagtcgctggag
gtactggccggcggcggtccggccgatgtcgtcgagctcaccgtggcgctcgccgccgag
atgctcgccgcggccggcgtgaccgatgtcgacccggccgagaagctcaaggacgggacg
gcgatggacgtctggcgccggatgatcgcggcccagggcggcgatccggacgccgagctg
ccggtcgccccggagcagcacgtggtcaaggccgaaacgtccggtgtgctgagccgcctc
gacgcgctggcggtcggagtcgccgcctggcgcctcggtgccgggcgggcgcgcaaggag
gacccggtttcaccggtcgccggtgtcgagctgcacgcgaagccgggcgaccaggtcacc
gccgggcaaccgctgctcaccctgcacgccgacgacccgagccgcttcgagcgggcactg
gagtcgctggccgacgccgtggagatcggtgacgcgtacgacgcgaccccgctggtgatc
gaccgcatcaccgcctga

DBGET integrated database retrieval system