KEGG   Kribbella flavida: Kfla_1414Help
Entry
Kfla_1414         CDS       T01155                                 

Definition
Uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
kfl  Kribbella flavida
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Kfla_1414
Enzymes [BR:kfl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Kfla_1414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1491395..1492522
Genome map
AA seq 375 aa AA seqDB search
MASRPGPLSGCTIAVTAHRRADDLIASFERRGAKVLHAPTLQIVPAPDDQTLIEATRRVI
ANPPDDVVVTTAVGFRGWVEAADTAGLAADLLGTLEQARLLARGPKARGAIRAAGLVEHW
SARSETTTEVVEWLKDQGVAGRKIVVQLHGMSEPGLQDTLRQAGASVRGLEVYRWGPAPD
PVVVERVIGQISAGAVDAVVHTSAPAAQAMLDAAALNGQYDALVTALRTGRVLNACVGPV
TAGPFVALGLEPLVPDRYRLGALIRSVTDRLTDENARSIETAYGQLVIRGGAAVLDGVVL
PLGPGPRAVLAALVAAGGDVVSRPELLAVLPGAEDVHAVEVTVNRLRTAVGKPELVRTVV
RRGYRLAVEPAAVPS
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
gtggcgagtaggcccgggccgctcagcggctgcacgatcgccgtcaccgcgcaccggcgg
gccgacgacctgatcgcgtcgttcgagcgtcggggcgcgaaggtgctgcacgcgccgacg
ctgcagatcgtgccggcgccggacgaccagacgctgatcgaggcgacccggcgggtgatc
gcgaacccgccggacgacgtggtggtgaccaccgcggtcgggttccgcggctgggtcgag
gcggccgacaccgccggactggcggccgacctgctgggcacgctggagcaggcccggctg
ctggcccggggtccgaaggcgcgcggcgcgatccgggccgccgggctggtggagcactgg
tcggcgcgctcggagaccacgaccgaggtcgtcgagtggctgaaggaccagggcgtggcc
ggccgcaagatcgtcgtgcagctgcacggcatgtcggaaccgggtctgcaggacacgctg
cggcaggccggcgcgtccgtgcggggactggaggtctaccggtggggtccggcgccggac
ccggtggtggtcgagcgggtgatcgggcagatctccgccggcgctgtcgacgctgtcgtc
cacacgtcggcaccggcagcacaggcgatgctcgacgcggccgcgctgaacggccagtac
gacgcactggtgaccgcgctgcggaccgggcgggtgctgaacgcctgcgtcggcccggtg
accgccgggccgttcgtggcgctggggctggagccgctggtgcccgaccggtaccggttg
ggagcgttgatccggagcgtgaccgaccggctgaccgacgagaacgcgcggtcgatcgag
acggcgtacgggcagttggtgatccggggtggggccgcggtgctcgacggcgtggtgctg
ccgttgggcccggggccgcgggccgtgctggccgcgctggtggccgccggtggcgacgtg
gtgtcgcgaccggagttgctcgcggtgctgccgggggccgaggacgtccatgcggtggag
gtgacggtgaacaggttgcgcacagcggtcgggaaacccgagctggtacggaccgtcgta
cggcgggggtaccggttggccgtcgagccggcagcggtgccgtcatga

DBGET integrated database retrieval system