KEGG   Kribbella flavida: Kfla_1462Help
Entry
Kfla_1462         CDS       T01155                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
kfl  Kribbella flavida
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Kfla_1462
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kfla_1462
   00052 Galactose metabolism
    Kfla_1462
   00500 Starch and sucrose metabolism
    Kfla_1462
   00520 Amino sugar and nucleotide sugar metabolism
    Kfla_1462
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Kfla_1462
   00524 Butirosin and neomycin biosynthesis
    Kfla_1462
Enzymes [BR:kfl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Kfla_1462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1541241..1542170
Genome map
AA seq 309 aa AA seqDB search
MTSDKPFRPPADGVVYGALDVGGTHVTGALIAFDQRQPVVRSVTRVSLQPDGTAEHLLST
IASCADSLAGRSGMDWAVAVPGPFDHERGVAQYRSVGKFDALYGVDLRGELSARMQARPG
SLTFVNDAEAFLIGEWSHGAASGHVRVVGITLGTGVGSAFLADGTIVADGPLVPPEGRAD
LLQHDGRPLEDTVSRRAIIARYRERTGQLLDVRDIAARARGGEAVAQTLLDGTFRALGQA
LDPWLLRFAPTLVVVGGSMTGSWDLLEPAISSGLTGRYAASGVLARAAHPDSAALVGAVQ
QVRRTERLE
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgacctctgacaagcctttccgcccgcctgccgatggtgtcgtgtacggcgccttggac
gtcggtggcacccatgtgaccggtgcgctgatcgccttcgaccagcggcagccggtggtc
cgttccgtgacacgggtctcgcttcagccggacggcacggccgagcatctgctgtcgacc
atcgcgtcttgcgcggactccctggccggccgttccgggatggactgggcagtcgccgtc
ccgggccccttcgatcacgagcgcggcgtggcgcagtaccggtccgtcggcaagttcgac
gccctgtacggcgtggacctgcgcggcgagctgtccgcgcggatgcaggcccggccgggt
tcgctcacgttcgtgaacgacgccgaggcgttcctgatcggcgagtggagccacggagcg
gcgtccgggcacgtgcgcgtcgtcgggatcaccttgggtaccggcgtcggcagtgccttt
cttgccgacggcaccatcgtcgccgacggtccgctggtcccgccggagggccgcgcggat
ctgctgcagcacgacggccggccgctcgaggacactgtcagccggcgggcgatcatcgcg
cgctaccgcgagcggaccggacaactgctggatgtccgcgacatcgcggcgcgggcgcgc
ggcggcgaggctgtcgcacagaccctgctggacgggaccttccgggcgctgggccaggcg
ctggatccgtggctgctccgcttcgcgccgaccctcgtcgtggtcggcggctcgatgacc
gggtcgtgggacctgctcgaaccggcgatcagttccgggctcaccggccggtacgccgcg
tccggcgtactggctcgtgccgcgcacccggacagtgccgcgttggtcggagctgtccag
caggtgcgtcgtacagaacgcctagagtga

DBGET integrated database retrieval system