KEGG   Kribbella flavida: Kfla_1714Help
Entry
Kfla_1714         CDS       T01155                                 

Definition
Cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
kfl  Kribbella flavida
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:kfl00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1810467..1811585)
Genome map
AA seq 372 aa AA seqDB search
MTRTRWSALAVSVLLTATALVTTTATTSSAAPVRYESVNAAISPGVGPTADSLTVDTVAA
TTPVAINGQLRVCGTKLCNQYGKPIQLRGMSTHGLQWYSHCVKTASLDALANDWKADILR
ISMYVQEGGYQTDPRRFTDLVHHYIEEATRRGLYALVDWHQLDPGDPNANLALAKTFFTE
IADRHKFKTNIIYDIANEPNNVSWAGIKSYAEQMIPVIRAKDPDSVVFVGTHGWASLGIS
DGRTEADIVNNPINATNFMYTFHFYAASHQDEYFNALARAADRIPLFVTEFGTQTYTGDG
GNDFTSAQKYLDFLASKKIGWTNWNFSDDFRSGAVFIQGTCAGNSFTGTSVLKPAGVWVR
DRIRTPDDFPTS
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgtacccgctggtcggcgctggcagtcagtgtgctgctgaccgccaccgccctg
gtcaccacgaccgcgaccaccagttccgccgcccccgtccgctacgagtccgtgaacgcc
gcgatctccccaggcgtcggcccgacggccgactcgctcaccgtcgacacggtcgccgcc
accaccccggtcgcgatcaacggccagctccgggtctgcggcaccaagctgtgcaaccag
tacggcaagccgatccagctgcgcggaatgagcacgcacggcctgcagtggtacagccac
tgcgtcaagaccgcctcgctcgatgccctggccaacgactggaaagccgacatcctgcgc
atctcgatgtacgttcaggagggcggttaccagaccgacccgcggcggttcaccgacctg
gtgcaccactacatcgaggaggccacccggcgcggcctctacgcgctggtcgactggcac
cagctcgacccgggtgacccgaacgccaacctggcgctggccaagacgttcttcaccgag
atcgccgatcggcacaagttcaagaccaacatcatctacgacatcgccaacgagccgaac
aacgtctcctgggccggcatcaagtcgtacgccgagcagatgatcccggtgatccgcgcc
aaggaccccgacagcgtggtcttcgtcggcacccacggctgggcctcgctcggcatctcg
gacgggcggaccgaggccgacatcgtcaacaacccgatcaacgcgacgaacttcatgtac
accttccacttctacgccgcgtcgcaccaggacgagtacttcaacgccctggcccgagcc
gcggaccggatcccgctgttcgtcaccgagttcggcacccagacctacaccggtgacggc
ggcaacgacttcacctccgcgcagaagtacctcgacttcctggccagcaagaagatcggc
tggaccaactggaacttctccgacgacttccgctccggcgccgtcttcatccaaggcacc
tgcgccgggaactcgttcaccggcaccagcgtgctgaagcccgccggcgtctgggtccgc
gaccggatccgcaccccggacgacttcccgaccagctga

DBGET integrated database retrieval system