KEGG   Kribbella flavida: Kfla_1714Help
Entry
Kfla_1714         CDS       T01155                                 

Definition
Cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
kfl  Kribbella flavida
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Kfla_1714
Enzymes [BR:kfl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Kfla_1714
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1810467..1811585)
Genome map
AA seq 372 aa AA seqDB search
MTRTRWSALAVSVLLTATALVTTTATTSSAAPVRYESVNAAISPGVGPTADSLTVDTVAA
TTPVAINGQLRVCGTKLCNQYGKPIQLRGMSTHGLQWYSHCVKTASLDALANDWKADILR
ISMYVQEGGYQTDPRRFTDLVHHYIEEATRRGLYALVDWHQLDPGDPNANLALAKTFFTE
IADRHKFKTNIIYDIANEPNNVSWAGIKSYAEQMIPVIRAKDPDSVVFVGTHGWASLGIS
DGRTEADIVNNPINATNFMYTFHFYAASHQDEYFNALARAADRIPLFVTEFGTQTYTGDG
GNDFTSAQKYLDFLASKKIGWTNWNFSDDFRSGAVFIQGTCAGNSFTGTSVLKPAGVWVR
DRIRTPDDFPTS
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgtacccgctggtcggcgctggcagtcagtgtgctgctgaccgccaccgccctg
gtcaccacgaccgcgaccaccagttccgccgcccccgtccgctacgagtccgtgaacgcc
gcgatctccccaggcgtcggcccgacggccgactcgctcaccgtcgacacggtcgccgcc
accaccccggtcgcgatcaacggccagctccgggtctgcggcaccaagctgtgcaaccag
tacggcaagccgatccagctgcgcggaatgagcacgcacggcctgcagtggtacagccac
tgcgtcaagaccgcctcgctcgatgccctggccaacgactggaaagccgacatcctgcgc
atctcgatgtacgttcaggagggcggttaccagaccgacccgcggcggttcaccgacctg
gtgcaccactacatcgaggaggccacccggcgcggcctctacgcgctggtcgactggcac
cagctcgacccgggtgacccgaacgccaacctggcgctggccaagacgttcttcaccgag
atcgccgatcggcacaagttcaagaccaacatcatctacgacatcgccaacgagccgaac
aacgtctcctgggccggcatcaagtcgtacgccgagcagatgatcccggtgatccgcgcc
aaggaccccgacagcgtggtcttcgtcggcacccacggctgggcctcgctcggcatctcg
gacgggcggaccgaggccgacatcgtcaacaacccgatcaacgcgacgaacttcatgtac
accttccacttctacgccgcgtcgcaccaggacgagtacttcaacgccctggcccgagcc
gcggaccggatcccgctgttcgtcaccgagttcggcacccagacctacaccggtgacggc
ggcaacgacttcacctccgcgcagaagtacctcgacttcctggccagcaagaagatcggc
tggaccaactggaacttctccgacgacttccgctccggcgccgtcttcatccaaggcacc
tgcgccgggaactcgttcaccggcaccagcgtgctgaagcccgccggcgtctgggtccgc
gaccggatccgcaccccggacgacttcccgaccagctga

  All links  
No link information was found.   
DBGET integrated database retrieval system