KEGG   Kribbella flavida: Kfla_1749Help
Entry
Kfla_1749         CDS       T01155                                 

Definition
glycoside hydrolase clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
kfl  Kribbella flavida
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:kfl00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:kfl00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:kfl00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1842925..1845051
Genome map
AA seq 708 aa AA seqDB search
MSNINVLQLRSAGVSLVLDCSGPALPSVLHWGADLGELSDSALVEFRRGAGAVQTGNGLN
DDLPVSVVPEYSAGWFGLPGLTGHRDGRDFSAAFRLENGTRDGNVVSVAAVDPVAQLKLA
LTIELTDSGLVKAKADLTNTGGSAYTVDGLVLALPVPTEATELLDLTGRHIGERHPQRHA
FTQGAHLRDNRRGRTGADATLLLIAGTRGFGFGFGEVWGLHTAWSGNHRSYAERGMSGYA
VIGGGELLLPGEGRLEPQGSYSTPWIYGSYGVGLDQLSARFHEYLRARPTHPSTDRPVVL
NTWEAVYFDLDLTKLTALADAAAEVGAERFVLDDGWFRGRRNDRAGLGDWYVDEGIWPKG
LHPLVDHVTGLGLQFGLWVEPEMVNPDSDLAREHPDWILATGNRTPPTARYQQGLNLGIP
AAYDYILERLDALLNEYDISYLKWDHNRDFVDGGNQLTGAAGIHEQTLAVYRLLDELKRR
HPGLEIESCSSGGARVDLAVLERTDRVWGSDSNDALERQKIQRYTQLLLPPELIGCHVGP
PRAHTTGRTQTLAFRAATALFGHFGIEWDISAASAEERAQLAGWVALHKELRPLLHTGRV
VRADRGPEDVLLHGVVAQDGSRAVYSAVQLTQSVTSDVGRVRLPGLEPQRTYRVSKMATP
GPEPRHPATWWVDGGQVELNGAALAAVGIQVPAQWPESAILLDVRAID
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgaacatcaacgtgctgcagctccgctccgcgggcgtcagtctcgtgctggactgc
tccggtccggccctaccgtcggtgctgcactggggcgcggacctgggtgagctgagcgac
agcgcgctggtggagttcaggcgcggcgccggcgcggttcagaccggcaacggcctgaac
gacgacctcccggtctccgtcgttccggagtactccgccggctggttcggcctgcccggg
ctcaccgggcaccgcgacggccgggacttctccgccgcgttccggctggagaacggcacc
cgcgacggcaacgtcgtctcggtcgccgccgtcgatccggtcgcgcagctgaagctcgcg
ctgaccatcgagctgaccgactccggtctggtcaaggcgaaggccgacctgacgaacacc
ggcggttcggcgtacacggtggacgggctggtgctcgcgctgccggtgccgaccgaggcg
accgaactgctcgacctgaccggccggcacatcggcgagcggcacccgcagcggcacgcg
ttcacccaaggggcgcacctgcgcgacaaccgccgcggccgcaccggtgccgatgccacc
ctgctgctgatcgccggcacccgcggcttcggcttcggcttcggcgaggtgtggggcctg
cacaccgcctggagcggcaaccaccgctcgtacgccgaacgcggcatgagcgggtacgcc
gtgatcggcggcggcgagctgctgctgcccggcgagggccggctggaaccgcagggcagt
tacagcacgccctggatctacggctcgtacggcgtcggcctcgaccagctgtcggcccgc
ttccacgagtacctgcgggcccgcccgacgcacccgtcgacggaccgcccggtggtgctg
aacacctgggaagccgtctacttcgacctcgacctgaccaagctcacggcgctcgccgac
gcggccgccgaggtcggcgccgagcggttcgtgctcgacgacggctggttccgcggccgt
cgcaacgaccgcgccggcctgggcgactggtacgtcgacgaggggatctggccgaagggc
ctgcacccgctggtcgaccacgtcaccggcctcgggctgcagttcggcctctgggtggag
cccgagatggtcaaccccgactccgacctggctcgcgagcacccggactggatccttgcc
accggcaaccggacgccgccgaccgcgcggtaccagcagggcctcaacctgggcatcccg
gcggcgtacgactacattctcgagcggctcgacgcgctgctgaacgagtacgacatctcc
tacctcaagtgggaccacaaccgggatttcgttgatggtggcaaccagttgaccggcgcg
gcgggcattcacgagcagacgctcgccgtctaccggctgctggacgagctgaagcgccgg
cacccagggctggagatcgagtcctgctcgtccggcggcgcccgggtcgacctcgcggtg
ctggagcggaccgaccgggtctggggcagcgacagcaacgacgcgctggagcggcagaag
atccagcgctacacccagctgctgctgccgccggagctgatcggctgccacgtcggtccg
cccagggcgcacaccaccggccggacccagaccttggcctttcgggcggcgaccgcgctg
ttcggccacttcggcatcgagtgggacatcagcgcggcgtcggccgaggagcgcgcgcaa
ctggcaggctgggtcgcgctgcacaaggagcttcggccgttgctgcacaccggccgggtg
gtccgggccgaccgtgggcctgaggacgtcctgctgcacggcgtcgtcgcgcaggacggt
tcccgcgcggtctacagcgccgtccagctgacccagtcggtcacctccgacgtgggccgg
gtccggctgcccggcctggaaccgcagcggacgtaccgcgtcagcaagatggccacgccc
ggccccgagccgcggcaccccgcgacctggtgggtcgacggtggccaggtggaactgaac
ggcgccgctctcgccgccgtcgggatccaggtcccggcccagtggcccgagagcgcgatc
ctgctggacgtccgagccatcgactga

DBGET integrated database retrieval system