KEGG   Kribbella flavida: Kfla_1803Help
Entry
Kfla_1803         CDS       T01155                                 

Definition
isochorismatase hydrolase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
kfl  Kribbella flavida
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:kfl00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1896991..1897566)
Genome map
AA seq 191 aa AA seqDB search
MARALIVVDVQNDFCEGGSLAVAGGADVAFRIGQLLHEWHEAEPRDRQYGYVVATRDHHI
DPGDHFSDQPDFVNSWPRHCVAGTDGVGFHPNLDPQPFDAIFDKGEYAAAYSGFEGKSQD
GEALAGWLRDKGVTEVDVCGIATDYCVRATALDAHREGFTTTVLTGLTAGVAPASTEQAL
VELRTAGVTLV
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgggcgttgatcgtggtggacgtgcagaacgacttctgcgagggcggcagcctg
gccgtcgcgggcggcgcggacgtcgccttccggatcgggcagctgctgcacgagtggcac
gaggccgagccacgcgaccggcagtacgggtacgtcgtcgccacccgcgaccaccacatc
gacccgggcgaccacttctccgaccagcccgacttcgtgaactcctggccccggcactgc
gtggccggcaccgacggcgtcggcttccacccgaacctggatccccagccgttcgacgcg
atcttcgacaagggcgagtacgccgcggcgtactcgggcttcgagggcaagtcgcaggac
ggcgaggcactggccggctggttgcgggacaagggcgtcaccgaggtcgacgtgtgcggc
atcgccaccgactactgcgtgcgcgccaccgcgctggacgcccaccgcgagggcttcacc
accacggtgctgaccggtctcaccgccggggtggccccggccagcaccgagcaggccctc
gtcgagctccgcaccgccggcgtcaccctcgtctga

DBGET integrated database retrieval system