KEGG   Kribbella flavida: Kfla_1831Help
Entry
Kfla_1831         CDS       T01155                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
kfl  Kribbella flavida
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:kfl00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1931876..1933825
Genome map
AA seq 649 aa AA seqDB search
MTGLYFGGDYNPEQWPPEVWKHDVALMRRAGANLVTVGVFAWSSLEPEPGRYEFGWLDQV
MDLLAEGGVQVDLATPTASPPPWFSLRHPEALPVNADGTRLTHGSRDTYCACAPAYREAA
AGIARALGERYAGHPALAMWHVHNEYGTTCYCDHAAEAFRRWLRDRYGDLDRLNGAWTTA
FWSQGYASWEEVRPPRATQYLVNPTHALDFRRFWSDELLAAYQEQQQILRAFTPDLPITT
NFVFGAWVPVDHARWAAEVDLVAIDHYPGDPGIGAEQQTALGADLARSWAGGRSWLLMEQ
AAGSVNDGQRLHTKEPGRMTRHSLAHVARGSKGALFFQWRASRGGAEMWHSALVPHAGAE
TRRFREVAELGALLPRLAELEQSAVQADVAVLWDVESWWAMQATHLPSSELDYLAAVQAA
HRQLWATGVGVDLPGPAADLSAYRLVVVPSLYLVSAEAAASIARYVEGGGHVLVTYFSGI
VNDDAQVWLGGYPGAFADLLGIRVEEFHPAAEVELASGARGRIWSEDVQLAGAEVIDRYA
GGVLDGSPAVTRNVYGEGVAWYVSTQLEDDAYRAVLEQAMRGAGIELPELPAGVELVRRR
ADGTTWSFLINHGDEEAVVPVDGVDLVSGAEVRGSVTLPAGGQAVVRSV
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgacgggtctgtacttcggcggcgactacaaccccgagcagtggccgccggaggtgtgg
aagcacgacgtcgcgctgatgcggcgggccggggccaacctggtgaccgtcggagtgttc
gcctggtccagcctcgagcccgagccgggacggtacgagttcggctggctcgaccaggtg
atggacctgctcgccgagggcggggtgcaggtggacctggccacgccgaccgcgtcaccg
ccgccatggttcagcctgcggcatcccgaggccttgccggtgaacgctgacgggacacgc
ctgacgcacgggagcagggacacgtactgcgcctgcgcaccggcgtaccgggaggcggcg
gcggggatcgcgcgagcactgggcgagcggtacgccgggcatcccgcgctggcgatgtgg
cacgtgcacaacgagtacggcacgacgtgttactgcgaccatgctgcggaggccttccgg
cggtggctgcgcgaccggtacggcgacctggatcggttgaacggggcgtggacgacggcg
ttctggagtcaggggtacgcgagctgggaggaggtccggccgccccgcgccacgcagtac
ctggtgaatccgacgcacgcgctggacttccggcggttctggtccgacgaactgctcgcc
gcgtaccaggagcagcagcagatcttgcgggccttcacgccggacctgccgatcaccacc
aacttcgtcttcggcgcctgggtcccggtcgaccacgcgcgatgggccgccgaggtggat
ctggttgccatcgaccactatcccggcgacccggggatcggcgcggagcagcagacggcg
ctcggggcggacctggcccggtcgtgggccggcggccggtcctggctgctgatggagcag
gcggccgggtccgtgaacgacgggcaacgcctgcacaccaaggaacccgggcggatgact
cggcacagcctggcgcacgtcgcccgcggctcgaagggtgcgctgttcttccagtggcgg
gcgtcgcggggcggggccgagatgtggcactccgcgctggtcccgcacgccggtgccgag
acccggaggttccgcgaggtcgccgagctcggggcgttgctgccgcggctcgccgagctc
gagcagagcgcggtgcaggccgacgtcgcggtgctctgggacgtggagtcctggtgggcg
atgcaggcgacccacctgccgtcgtcggagctggactacctcgccgcagtgcaggccgcg
caccggcagttgtgggccacgggggtcggggtggatctgcctgggcccgcggccgacctc
tcggcgtaccggctggtggtggtgccgagcctgtacctggtgtcggccgaggcggccgcc
tcgatcgcgcggtacgtcgagggcggcggacatgtcctggtgacgtacttcagcgggatc
gtgaacgacgacgcgcaggtctggctcggcgggtatccgggtgcgttcgcggacctgctc
gggattcgcgtcgaggagttccacccggccgccgaggtcgagctcgcatcgggtgcgcga
gggcggatctggagcgaggacgtgcagctggccggtgccgaggtgatcgatcggtacgcc
ggtggtgtgctggacggatcgccggccgtcacccggaacgtgtacggcgagggcgtcgcc
tggtacgtgtccactcaactcgaggacgacgcgtaccgcgctgtgctggagcaggcaatg
cgcggagcaggcatcgagctgcccgaactgcccgcaggggtcgaactggtccggcgtcgc
gcggacggcacgacctggtccttcctgatcaaccacggcgacgaggaggccgtcgtaccg
gttgacggggtggatctggtgtccggtgcggaggttcggggcagtgtgaccttgccggcc
ggcggtcaggcggtcgtgcgctcggtgtga

DBGET integrated database retrieval system