KEGG   Kribbella flavida: Kfla_2116Help
Entry
Kfla_2116         CDS       T01155                                 

Definition
aldehyde ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
kfl  Kribbella flavida
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Kfla_2116
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Kfla_2116
Enzymes [BR:kfl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Kfla_2116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2205424..2207232
Genome map
AA seq 602 aa AA seqDB search
MPPGGYFGQALVIDVSDGSSTVLPLLDDVLRAYLGGAGLGVWLLTQLGEAGVDPLDPAAP
LAFVFSPLVGTPLTTSAKFAVVAKSPLTGLLTDALASSHFAIAGKFTGYDAIVLTGRSAT
PANVFVDESGVRVLDASAQWGLSAGQAEESIRTQYGRTWRAASIGPAGEALVRYATISHD
GRHAGRGGLGAVLGAKNVKALAVKGRKRVSLHDKDGVLAAAKDLRGRSFGPATEKYRELG
TLANLLAFNAISTLPTRNFQAATFDGAARLSAEDLASKRSVAKTSCASCTIGCEHIYATK
GGGKVRVEYENMFALGPMCGVSDPDLVLAASARCDELGLDTISAGGTIAWAMECVDRGLL
DVPWLRFGDGDALLRALDEISARTGVGVLLSEGTRRAAGIVGQGSLAFAAQVKGLEMPGY
EPRTMQSMALGLAVNARGADHNRSGAYEADLKGGLDRVRGTDEHVRAAIETEDRAAIMDS
LILCKFLRGVFTEPFGEWAALLAGVTGWDVDGAELRETARRIVHAKRAYNLREGWTPEDD
WLPDRFLDSSLELASGRTATLPAERLRSMIARYYAERGLDADGRPTALPTTVTTATGTEP
TP
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgcctccaggtggctacttcggccaagcactggtgatcgacgtctcggacggctcctcc
accgtcctgccgctgctggacgacgtgctgcgcgcctacctcggcggcgcgggtctcggc
gtctggctgctgacccagctcggcgaagccggcgtcgatcccctcgacccggccgccccg
ctggccttcgtcttctccccgctggtcggtacgccgctgaccacgagcgccaagttcgcg
gtggtcgccaagtcgccgctgaccgggttgctcaccgacgcgctcgcctccagccacttc
gcgatcgccggcaagttcaccgggtacgacgcgatcgtgctcaccggccggtcggcgaca
ccggcgaacgtgttcgtcgatgagtcgggcgtccgggtgctcgacgcgtccgcgcagtgg
ggcctgtccgcgggacaggccgaggagtccatccggacgcagtacgggcggacgtggcgg
gcggcgagcatcggcccggccggcgaggcgctcgtccggtacgcgaccatctcgcacgac
ggccggcacgccggacgcggtggcctgggggccgtgctcggcgcgaagaacgtcaaggca
ctcgcggtgaagggccgcaaacgggtgtcgctgcacgacaaggacggcgtgctcgcggcg
gccaaggacctgcgcgggcggtcgttcggcccggccaccgagaagtaccgggagctcggc
acgctggcgaacctgctggcgttcaacgcgatcagcaccctgccgacccgcaacttccag
gcggccaccttcgacggcgcggcgcggctctcggccgaggacctggcgtcgaagcgctcg
gtggccaagaccagctgcgcgtcctgcacgatcgggtgcgagcacatctacgcgaccaag
ggcggcggcaaggtccgggtcgagtacgagaacatgttcgcgctcgggccgatgtgcgga
gtgtccgaccccgacctggtgctggccgcgagcgcccgctgcgacgagctcgggctggac
accatctcggccggcggcacgatcgcctgggcgatggagtgtgtggaccgcggtctgctg
gacgtcccgtggctgcgcttcggtgacggcgacgcgctgctgcgggcgctggacgagatc
agtgcccgtaccggcgtcggggtcctgctgtccgagggcacccggcgagcggccggcatc
gtcggccagggctcgctggcgttcgccgcgcaggtcaagggcctggagatgccggggtac
gaaccgcgcacgatgcagtcgatggcgctcgggctggccgtcaacgcccgcggagcggac
cacaaccggtccggcgcctacgaggccgatctgaagggcggcctcgaccgggtccgcggc
accgacgagcacgtccgcgcggccatcgagaccgaggaccgggccgcgatcatggactcg
ctgatcctctgcaagttcctgcgcggtgtcttcaccgagcccttcggcgagtgggccgcg
ctgctggccggcgtcaccggctgggacgtcgacggcgccgagctgcgcgagaccgctcgc
cggatcgtgcacgccaaacgcgcctacaacctgcgcgagggctggacccccgaggacgac
tggctgccggaccggttcctggacagctcgctcgaactggcgtcgggccggaccgccacc
ctgccggccgagcggctgcgctcgatgatcgcccgctactacgccgagcgcggactggac
gccgacggccgccccaccgccctgcccaccaccgtcaccaccgctaccggaacggagccg
acaccatga

DBGET integrated database retrieval system