KEGG   Kribbella flavida: Kfla_2240Help
Entry
Kfla_2240         CDS       T01155                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
kfl  Kribbella flavida
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Kfla_2240
Enzymes [BR:kfl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Kfla_2240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2331471..2333588
Genome map
AA seq 705 aa AA seqDB search
MTAPTAALVDLAVAHGVATEYWDWQGKHVQVSREVVSAVLGALGVDASTPAKAANALVEY
QQSRWRRVLPPTVVMRTGWTPWFAVHVPHGSPVEVWVELEDGGQRRDVPQQQRWVEPEWV
DGVQIGEATFQLPGDLPLGYHRICARIGGDPEVFTGTLIVTPQRLEPQKLERNWGWVLQL
YSVRSRRSWGIGDLHDLADLAAWSAGDLGAGFVLVNPLHAAETSGRMEPSPYLPASRRFA
NPIYLRIEDIDEYGDLAPAERDRVRTLGLQTRALNEDATALDRDTVWAAKREALQLLFGV
RPSIGRIAEYGAYCDREGQGLIDFATWAAIADVHGPEWSKWPEELRDPAAPAVVAFRNEN
PDAVEFHCWLQWQLDEQLARTQARARNAGMALGVLHDLAVGVHPDGADAWALQNVLAAGI
HVGAPPDAFNQQGQDWSQPPWRPDALARTGYAAWRDLVRAQLRHAGGLRIDHILGLFRLW
WVTSPESPTEGTYIRYDHEALIGILVLEATRAGVVVVGEDLGTVEPWVRDYLTERGVLGT
SVLWFERDDQGRPLPPERWRELCLATVTTHDLPPTAGYLAGDHVELRDRLGLLTRPVAEE
LKVDEAERDAWLSALRERHLLSGHEGEVERIVEALHRYVAHTPAKLIGVALADAVGERRT
QNQPGTTDEYPNWRVPLGGPGGLPILIEDLPNNTRLRRLIGVLGH
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
gtgacagctcctaccgcggcccttgtcgatctggcggttgcccatggcgtggcgacggag
tactgggactggcagggcaaacatgtgcaggtctccagggaagtggtgtcggccgtgctg
ggcgccctcggtgtggacgcctccacgccggccaaggcggccaatgccctcgtcgagtat
cagcagtcccgctggcgccgggtcctgccgcccacggtggtgatgcggaccggctggacg
ccgtggttcgcggtgcacgtgccgcacgggtcgccggtcgaggtctgggtcgagctggag
gacggcggccagcgccgggacgtcccgcagcagcagcgctgggtcgagccggagtgggtg
gacggcgtccagatcggcgaggcgaccttccagctgcccggtgacctgccgctcggctac
caccggatctgcgcgcggatcggtggcgacccggaggtgttcaccggcacgctcatcgtc
accccgcagcgcctcgagccgcagaagctggagcgcaactggggctgggtgcttcagctg
tactccgtgcggtcacgccgctcgtggggcatcggcgacctgcacgacctcgccgacctg
gccgcctggtcggccggtgacctgggcgccgggttcgtcctggtgaacccgctgcacgcc
gccgagacgtccggccggatggagccgtcgccgtacctgccggcgtcgcgccggttcgcg
aacccgatctacctgcggatcgaggacatcgacgagtacggcgacctggcgccggccgag
cgggaccgggtccgcaccctcgggctgcagacccgggcgctgaacgaggacgccaccgcg
ctcgatcgggacaccgtctgggcggccaagcgggaggcgctgcagctgctgttcggcgtc
cggccgtcgatcggccggatcgcggagtacggcgcgtactgcgatcgcgaggggcagggg
ctgatcgacttcgccacctgggccgcgatcgcggacgtgcacggaccggagtggagcaag
tggcccgaggagctgcgggacccggccgctccggcggttgttgctttccgcaacgagaat
ccggacgcggtggagttccactgctggctgcagtggcagctggacgagcagctggcccgg
acccaggcccgggcccggaacgccgggatggcgctcggcgtcctgcacgacctggccgtc
ggggtgcacccggacggcgccgacgcctgggccctgcagaacgtgctcgcggccggcatc
cacgtcggcgctccgccggacgccttcaaccagcagggccaggactggtcgcagccgccg
tggcgcccggacgcgctggcccggaccgggtacgccgcctggcgggacctggtccgcgcg
cagctgcggcacgccggcgggctgcggatcgaccacattctcggcctgttccggctctgg
tgggtcacctcgccggagagcccgaccgaaggcacctacatccgctacgaccacgaggcg
ctgatcgggatcctggtcctggaggcgacccgggccggggtcgtggtggtgggggaggac
ctcggcacggtggagccgtgggtccgcgactacctgaccgagcggggcgtgctgggcacc
tcagtgctgtggttcgagcgggacgaccaaggccgtccgctgccgcccgagcggtggcgc
gagctctgcctggccacggtcaccacgcacgatctgccgccgaccgcaggctacctggcg
ggcgaccacgtcgagctcagggaccggctcggcctgctgacccggccggtcgccgaggaa
ctgaaggtcgacgaggccgagcgggacgcgtggctgagcgccctgcgcgagcggcacctg
ctgtccggccacgagggtgaggtcgagcggatcgtcgaggccctgcaccggtacgtcgcg
cacacgccggccaagctgatcggggtggcgctggccgacgcggtgggcgagcggcggacc
cagaaccagcccggcacgaccgacgagtacccgaactggagggtcccgctgggtggtccg
ggcggcctgccgatcctgatcgaggacctgccgaacaacacccgcttgcgccggctgatc
ggcgtcctcggacactga

DBGET integrated database retrieval system