KEGG   Kribbella flavida: Kfla_2492Help
Entry
Kfla_2492         CDS       T01155                                 

Definition
Mg-chelatase subunit ChlI-like protein
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
kfl  Kribbella flavida
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Kfla_2492
Enzymes [BR:kfl01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Kfla_2492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2606779..2608176
Genome map
AA seq 465 aa AA seqDB search
MTSAPADLPRKAGELRAAGYLPRTIKAEIRENLLTKLRAGDDPWPGIVGFSRTVIPQLER
ALLAGHDVVLLGERGQGKTRLLRTLLGLLDEWTPVIEGAELPEHPLDPITPASQRRAAEL
GDDLPVAWLHRSLRYAEKLATPDTSVGDLIGDVDPVKVAEGRSLGDPETIHFGLVPRAHR
GIVAINELPDLAERIQVALLNVMEERDIQVRGYTLRLPLDVLLVATANPEDYTNRGRIIT
PLKDRFGAEVRTHYPLDVDAEVDVVRQEAELTAEVGEPLLEVLARFVRHLRESTAIDQRS
GVSARFAVAAAETVAAAALRRSAITGEQPAVARPVDLEAVPAVLRGKLEFEPGEEGRETE
LLEYLLRRSVADTARERFAGLDLTPLANAVADGHLVTTGERIPGRDVLSALPELPVLHDV
AARAGVEADDSPGRIAAAVELALEALYLSKRLAKDADDDTTVYGA
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
gtgactagtgcacctgctgaccttccccggaaggccggcgagcttcgcgccgccggttac
cttccccgcaccatcaaggccgagatccgcgagaacctgctgaccaagctccgggccggc
gacgacccctggcccggcatcgtcgggttctcccgcaccgtgatcccccagctggagcgt
gccctgctcgccgggcacgacgtcgtgctgctcggcgagcgtggccagggcaagacccgc
ctgctgcgcactctgctcgggctgctcgacgagtggaccccggtgatcgagggcgccgag
ctgcccgagcacccgctcgacccgatcacgccggcctcgcagcggcgcgccgccgagctc
ggcgacgacctgccggtcgcctggctgcaccgcagcctccggtacgccgagaagctggcc
acgccggacacctcggtcggtgacctgatcggcgacgtggacccggtcaaggtggccgag
ggccgcagcctcggcgacccggagacgatccacttcggtctggtcccgcgcgcgcaccgc
ggcatcgtcgcgatcaacgagctgcccgacctggccgagcggatccaggtggcgctgctg
aacgtgatggaggagcgcgacatccaggtccgcggctacacgctccggctgccgctcgac
gtgttgctggtggcaacggccaaccccgaggactacaccaaccgcggccggatcatcacg
ccgctcaaggaccggttcggcgccgaggtgcggacccactacccgctcgacgtggacgcc
gaggtggacgtggtccggcaggaggccgagctgaccgccgaggtcggcgagccgctgctc
gaggtgctggcccggttcgtccggcacctgcgcgagtccaccgcgatcgaccagcgctcg
ggcgtctccgcccggttcgcggtcgcggcggcggagacggtcgcggcggcggccctgcgg
cgcagtgcgatcaccggcgagcagcccgcggtcgcccgtccggtcgacctggaagcggtg
ccggccgtgctgcgcggcaagctggagttcgagcccggcgaggagggccgcgagaccgag
ctgctggagtacctgctgcgccggtcggtcgccgacaccgcccgcgagcggttcgccggc
ctggacctgaccccgctggcgaacgcggtggccgacgggcatctcgtcaccaccggcgag
cggatccccggccgggacgtgctgtcggcgctgcccgagctgccggtgctgcacgacgtg
gccgcgcgggcgggcgtcgaggcggacgactcgccgggccggatcgcggccgcggtcgag
ctcgcgctggaggcgctctacctgtcgaaacgactggccaaggacgccgacgacgacacg
accgtctacggagcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system