KEGG   Kribbella flavida: Kfla_2585Help
Entry
Kfla_2585         CDS       T01155                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
kfl  Kribbella flavida
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Kfla_2585
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kfla_2585
   00052 Galactose metabolism
    Kfla_2585
   00500 Starch and sucrose metabolism
    Kfla_2585
   00520 Amino sugar and nucleotide sugar metabolism
    Kfla_2585
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Kfla_2585
   00524 Butirosin and neomycin biosynthesis
    Kfla_2585
Enzymes [BR:kfl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Kfla_2585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2715706..2716623)
Genome map
AA seq 305 aa AA seqDB search
MSDEATTVLGIDIGGTKMAAALVAADGRILTEDRIPTPRGDADQVFAALAELIGRVRGEV
TPVAVGIGSAGPLDQRHGLVSPVNIVGWRNFPLVDRVRELVGGVPVELGVDGHCFALGES
WTGAGRGVGTLLGIVVSTGVGAGIVMDGKPLLGQSGNAAHLGHMVVDLDGEVCACGSYGC
VETYASGPRMVARAQRRGWRSGELVDAAMLSADAAAGDEIALAVFDDGAQALAAGIVATA
VTVDLTTVVIGGGVAKAGPVLFDPVGRWVKRLAQLPFVADLTVEPAQLANAGLLGAARLA
WATTA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgaggcaacgaccgttctcggcatcgacatcggcggcacgaagatggccgcc
gcgctggtggccgctgacggccggatcctcaccgaggaccggatccccacgccgcgcggc
gacgccgaccaggtgttcgccgccctggccgagctgatcggccgggttcgcggcgaggtc
accccggtggccgtcggcatcggctcggcgggcccgctcgaccagcggcacggcctggtc
tcgccggtgaacatcgtcggctggcggaacttcccgctcgtcgaccgggtccgggagctg
gtcggcggcgtaccggtggagctcggggtcgacggccactgcttcgccctgggcgagtcg
tggaccggcgccggccgcggggtcggcacactgctgggcatcgtggtctcgaccggggtc
ggcgccggcatcgtgatggacggcaagccgctgctcggccagtccggcaacgccgcccac
ctcgggcacatggtcgtcgacctggacggcgaggtgtgcgcgtgcgggtcgtacggctgc
gtggagacgtacgccagcggcccgcggatggtggcgcgggcgcagcgccgaggctggcgg
tccggcgagctggtcgacgccgcgatgctgtcggcggacgccgcggccggggacgagatc
gcgctcgcggtgttcgacgacggcgcgcaagcgctggccgccggcatcgtcgcgaccgcg
gtcaccgtggacctcaccaccgtcgtcatcggcggcggcgtcgcgaaggccggtccggtc
ctgttcgacccggtcggccgctgggtgaagcggctggcgcagctgccgttcgttgccgac
ctcaccgtcgagccggcgcagctggccaacgccggcctgctcggcgccgcgcggctggcc
tgggcgaccacggcctga

DBGET integrated database retrieval system