KEGG   Kribbella flavida: Kfla_2647Help
Entry
Kfla_2647         CDS       T01155                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
kfl  Kribbella flavida
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:kfl00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2783866..2784492
Genome map
AA seq 208 aa AA seqDB search
MTTIRTELVETATPATLHVVGGRPAIDLAAAERAVADLLVALGRDPHSAHLAETPRRVAN
AYAEMLTPREFDLTTFPNDEGYDELVLARDIPVQSLCEHHMLPFQGVAHVGYLPGARILG
LSKLARVVELFARDLQVQERLTKQVADWLQLQLAPKGVGVVIEAEHQCMSLRGVRATGST
TVTSAVHGALRENPASRQEFFALTGIAA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgatccggaccgagctcgttgagaccgccacgccggcgaccctgcacgtggtg
ggagggcgtccggcgatcgacctggccgcggccgaacgggccgtcgcggacctgctggtc
gcgctcggccgggacccgcactccgcgcacctcgccgagaccccccgccgggtcgcgaac
gcgtacgccgagatgctgacgccgcgggagttcgacctgaccaccttcccgaacgacgag
gggtacgacgagctggtgctggcccgcgacatcccggtccagtcgctgtgcgagcaccac
atgctgccgttccagggcgtcgcgcacgtcggctacctgccgggtgcgcggatcctcggg
ctgtccaaactggctcgtgtggtcgagctgttcgcccgcgacctgcaggtccaggagcgg
ctgaccaagcaggtcgccgactggctgcagctccagctggcgccgaagggcgtcggcgtg
gtgatcgaggccgagcaccagtgcatgtcgttgcgcggcgtccgggcgaccggctcgacg
acggtcacctcggccgtgcacggcgcactgcgcgagaacccggcgtcccgccaggagttt
ttcgccctgaccgggatcgccgcctag

DBGET integrated database retrieval system