KEGG   Kribbella flavida: Kfla_2689Help
Entry
Kfla_2689         CDS       T01155                                 

Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
kfl  Kribbella flavida
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Kfla_2689
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Kfla_2689
  Amino acid metabolism
   00310 Lysine degradation
    Kfla_2689
Enzymes [BR:kfl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Kfla_2689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2829530..2831632)
Genome map
AA seq 700 aa AA seqDB search
MPTSVSLPALGESVTEGTVTRWLKQVGDTVAVDEPLLEVSTDKVDTEIPSPVAGTLLEIK
AAEDETVEVGAELAVIGDAGESSGSSSDAGSSDAAADASSGDAAQAQQAPAAEPQAASTE
SQAPAAEAQDSGAEASYSGSGSGAQDTDAAPAAQDPAQQAATDQASSSADASSGSATSSA
PADTQSSGGGGTSVTLPALGESVTEGTVTRWLKQVGDDVAVDEPLLEVSTDKVDTEIPSP
VAGKLLEIKVAEDETVEVGAELAVVGSADAAPAQAAPQQQAPQAEAPQAAPAQQSAPAQQ
APAQQAPAAQAAPAQQAPAAQPASQAPAAQPAAQAPAAQPAAQAPAAQPAAQAPAPQAAS
AQTSSPAASAAPQASAPAASAPASATASSNGSSTDAPNYVTPLVRKLAAEHGVDLNAVQG
TGVGGRIRKQDVLAAAEAKKAAPAAAAPAAASSGAPQAATPVSPLRGTTEKMSRIRKAIA
SHMVNSLKVSAQLTTVVEVDVTEIAKLRNAKKAEFEAREGVKLSFLPFFALAAVDALKQY
PKLNASIDDEKGEVTYHAAEHLGIAVDAEKGLMVPVVHNAGDLNIAGLAKKIADLAARTR
TNKVLPDEMAGGTFTITNTGSRGALFDTPILNQPQVGMLGTGAVVKRPVVITHPELGETI
AIRQMVYLALTYDHRLVDGADAARYLTAVKQRLEEAQFDV
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgccgacctctgtatccctgccggccctcggggagagcgtcaccgaaggaaccgtcacc
cgctggctcaagcaggtcggcgacaccgttgccgtcgacgagcccctgctggaggtctcg
accgacaaggtcgacaccgagatcccctcgccggtcgccggcaccctgctggagatcaag
gccgccgaggacgagaccgtcgaggtcggcgccgaactggccgtgatcggcgacgccggc
gagagctcgggctcctcgtccgacgccggctcgtccgacgccgccgccgacgcctcctcg
ggcgacgccgctcaggcccagcaggccccggccgccgagccgcaggccgcttccaccgag
tcccaggctccggctgccgaggcgcaggactccggcgccgaggcgtcgtactccggctcc
ggctcgggcgcgcaggacaccgacgcggcacctgctgcccaggaccccgctcagcaggcg
gcaaccgatcaggcttcttcttcggccgacgcatcctcgggatccgcgacctcctcggcg
ccggcggacactcagtcgtccggcgggggcggcacctccgtcacccttccggccctgggc
gagagcgtcaccgagggcaccgtcacccgctggctcaagcaggtcggcgacgacgtggcc
gtcgatgagccgctgctcgaggtctccaccgacaaggtcgacaccgagatcccgtcgccg
gtcgccgggaagctgctcgagatcaaggtcgccgaggacgagaccgtcgaggtcggcgcc
gagctcgccgtcgtcggttccgccgacgccgctcccgcgcaggcggctccgcagcagcag
gcaccgcaggccgaggcaccgcaggcagccccggctcagcagtcggcccctgcccagcag
gctccggcccagcaggctccggccgcccaggctgctccggctcagcaggcccccgcggcc
cagcccgcttctcaggcccccgccgcacagccggctgcccaggcccctgccgcacagccc
gccgcccaggcccctgccgcacagcccgccgcccaggcccctgctccgcaggccgcctcc
gcccagacctcttctccggccgcatccgcagcaccccaggcctccgctccggccgcatcg
gcaccggcctcggccaccgcctcctccaacggctcctccaccgacgccccgaactacgtc
acccccttggtgcgcaagctcgccgccgagcacggcgtcgacctcaacgccgtccaaggc
accggcgtaggcggccgcatccgcaagcaggacgtgctcgccgccgccgaagccaagaag
gccgcccccgccgcagccgccccggccgccgcatcgagcggcgccccgcaggccgccacc
ccggtcagcccgctgcgcggcaccaccgagaagatgagccgcatccgcaaggcgatcgcc
agccacatggtgaactcgctgaaggtctcggcccagctgaccacggtcgtcgaggtcgac
gtcaccgagatcgccaagctgcggaacgcgaagaaggccgagttcgaggcccgcgagggc
gtcaagctgtccttcctgccgttcttcgcgctcgccgcggtggacgccctgaagcagtac
ccgaagctgaacgcctcgatcgacgacgagaagggcgaggtgacgtaccacgccgccgag
cacctgggcatcgccgtggacgccgagaagggcctgatggtcccggtcgtgcacaacgca
ggagacctgaacatcgccggcctggccaagaagatcgccgacctggccgcgcgcacccgc
accaacaaggtgctgccggacgagatggcgggcggcacgttcaccatcaccaacaccggc
agccgcggcgccctgttcgacacgccgatcctgaaccagccgcaggtcggcatgctcggc
accggcgcggtcgtcaagcgcccggtcgtcatcacccacccggagctcggcgagacgatc
gccatccggcagatggtctacctggccctgacctacgaccaccgcctggtcgacggcgcc
gacgccgctcgttacctgaccgccgtcaagcagcgcctggaagaagcccagttcgacgtc
tga

DBGET integrated database retrieval system