KEGG   Kribbella flavida: Kfla_2718Help
Entry
Kfla_2718         CDS       T01155                                 

Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
kfl  Kribbella flavida
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:kfl00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2865166..2865927
Genome map
AA seq 253 aa AA seqDB search
MATSEDGRLAAELAAAAGGLLLDLRAAGGSGRTLGDRGDRSANELLIRGLRDRRPGDAVL
SEESADTAARLSADRVWIIDPLDGTREYGEPPRADWAVHVALWQRGELVAGAVALPALNV
VHGTDEPEPPPPRTEGRLRIAVSRSRPPVLVEKLAVELDAELVPMGSAGVKATAVLRGEV
DAYVHAGGQYEWDSAAPVAVARAAGLFCSRIDGSPLRYNQPDPSLPDLVVCRPELAQELL
AAIAVYESAEGDR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccagtgaagacggccggctggccgcggagctcgcggccgcagccggcgggctg
ctgctcgacctgcgcgcggccggaggttcgggacgcacgctgggggaccggggggaccgg
tcggcgaacgagctgctgatccgcggcctgcgggaccgtaggcccggcgacgccgtgctg
agtgaggagtcggccgacaccgcggcccggttgtccgccgatcgggtctggatcatcgac
ccgctcgacggcacccgcgagtacggcgagccgccgcgggcggactgggcggtgcacgtc
gcactctggcaacgcggtgaactcgtcgccggggccgtcgcgctgcccgcgctgaacgtc
gtgcacggcaccgacgagccggaaccgccaccaccacggaccgaggggcggttgcggatc
gcggtcagccggagccggccgccggtcctggtcgagaagctggcggtcgagctcgacgcc
gagctggtgccgatgggctcggccggggtgaaggcgacggcggtgctgcgcggtgaggtg
gacgcctacgtgcacgcgggtgggcagtacgagtgggactcggccgcgccggtcgcggtg
gcccgggcggccgggttgttctgcagtcggatcgacggctcgccgttgcgctacaaccag
ccggacccgagcctgccggacctggtggtctgccggcccgagctcgcgcaggagctgctg
gccgcgatcgcggtgtacgagtcggcggagggcgaccgatga

DBGET integrated database retrieval system