KEGG   Kribbella flavida: Kfla_2821Help
Entry
Kfla_2821         CDS       T01155                                 

Definition
ROK family glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
kfl  Kribbella flavida
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:kfl01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:kfl00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:kfl00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:kfl00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:kfl00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:kfl00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2990471..2991742
Genome map
AA seq 423 aa AA seqDB search
MVGPRCLAGTGEGRSWGYREEGRAMALTQALTIGIDIGGTKVAAGVVDPEGNILDRLRRD
TPTKDPKETEDAIAEVVHDLESRHDVIAVGIGAAGFVDGTRSSVLFAPHLAWRHEPLRDA
VERRLGLPVVVENDANAAAWSEWRFGGGQGESHLVCVTLGTGIGGAILNDGALQRGKFGI
AGEFGHMQVVPGGHRCECGNRGCWEQYASGNALTREARELALSGSPVAHNLLRAAEGDPR
RINGPMVTELAKDGDPVAVELLEDVGRWLGIGLANLAAALDPGTFVIGGGVSDAGELLLA
PAREAFKRTLTGRGFRPEARIVRAVLGPEAGMVGAADLAREEATWLRRVRVKTTAVTAKT
AARGGRSTRLDRAARKSASRRTGMRAATSEGELQLEHTGDLQLDLPAEPQLNQTRRNQGE
PEA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtggtcggtccgagatgcttggctggaaccggcgaaggccggagttgggggtaccgagag
gagggtcgtgcgatggctctgacgcaggcgttgacgatcggcatcgacatcggtggcacc
aaggtggccgccggagtggtcgaccccgagggcaacattctcgaccggctgcgccgggac
accccgaccaaggacccgaaggagaccgaggacgcgatcgccgaggtcgtgcacgacctg
gagtcgcggcacgacgtgatcgcggtcggcatcggcgccgccggattcgtcgacggcacc
cgttcctcggtgctgttcgcgccgcacctggcctggcggcacgagccgctgcgggacgcg
gtcgagcgccgcctcggcctgccggtggtggtggagaacgacgcgaacgccgccgcctgg
tcggagtggcggttcggcggcggccagggcgagagccacctggtctgcgtgacgcttggc
accggcatcggcggcgcgatcctgaacgacggcgctctgcagcgcggcaagttcggcatc
gccggcgagttcggccacatgcaggtggtgccgggcggtcaccgctgcgagtgcggcaac
cgcggctgctgggagcagtacgcgtccggcaacgcgttgacccgggaggcgcgggagctc
gcgctgtccggctcaccggttgcgcacaacctgctgcgcgccgccgagggcgacccgcgc
cggatcaacggcccgatggtcaccgagctggccaaggacggcgacccggtcgcggtcgag
ctgctggaggatgtcggccgctggctcggcatcggcctggcgaacctcgccgccgcgctg
gaccccggtacgttcgtgatcggtggtggcgtctccgacgccggcgagctgctgctggcg
ccggcccgggaggcgttcaagcggacgctgactgggcgggggttccggccggaggcgcgc
atcgtgcgcgccgtgctcggcccggaggcgggcatggtcggcgccgcggacctcgcccgc
gaggaggcgacctggctgcggcgggtgcgggtgaaaaccaccgcggtgacggcgaagacc
gccgcccgcggcggccggtcgacccggctggaccgggccgcccgcaagtcggcgagccgg
cggaccgggatgcgtgcggcgacctcggagggcgagctccagctcgagcacacgggcgac
ctgcagctggatctgcccgccgagccgcagctgaaccagacccggcgcaaccagggcgaa
ccggaggcatga

DBGET integrated database retrieval system