KEGG   Kribbella flavida: Kfla_2828Help
Entry
Kfla_2828         CDS       T01155                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
kfl  Kribbella flavida
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2996916..2997680)
Genome map
AA seq 254 aa AA seqDB search
MPVSAHAEEFRSPGNGPNAATGILLSHGFTGSPKSMRPFAEHLAAEGYGVAVPRLPGHGT
HWREANGTTWQDWYAVLDNEFERLRKEHDRVFLAGLSMGGCLVLRLAEQHGEDVAGLVLV
NPSVQTDDKRLVLLPVLQRLLPSFPGVANDIKKPGVDEGAYDRLPLRALHSLAQLWKVTR
EDLPKVTQPVLLFRSTVDHVVEPSSGRTVLARISSRDVTETLLEDSYHVATLDNDAPRIF
AGTTAFVRRIGSHA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgtgtcagctcatgcggaggagttccgcagtcccggcaacggcccgaacgccgcg
acggggatcctgctcagccacggcttcaccggatcgccgaagtcgatgcgcccgttcgcc
gagcacctggccgcggagggctacggcgtggccgtcccccggctgcccgggcacggcacg
cactggcgagaggcgaacggcaccacctggcaggactggtacgccgtgctcgacaacgag
ttcgagcggctgcgcaaggagcacgaccgggtcttcctggccgggctgtcgatgggcggc
tgcctggtgctgcggctggccgagcagcacggcgaggacgtggccgggctggtcctggtc
aacccgtcggtgcagaccgacgacaagcggctcgtgctgctgccggtgctgcagcggctg
ctgccgtcgttccccggcgtcgcgaacgacatcaagaagccgggcgtcgacgaaggcgcg
tacgaccggctgccgctgcgcgcgctgcactcgctggcgcaactgtggaaggtgacgcgg
gaggatctgccgaaggtgacccagccggtgcttctgttccgcagtactgtcgatcacgtc
gtcgaaccgagctccggccggacggtactggcccggatctcgtcccgcgacgtgaccgag
accctgctcgaggacagctaccacgtggccactctggacaacgacgcaccgcgcatcttc
gccggcacgaccgccttcgtccgccggatcggcagccatgcgtga

DBGET integrated database retrieval system