KEGG   Kribbella flavida: Kfla_3014Help
Entry
Kfla_3014         CDS       T01155                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
kfl  Kribbella flavida
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:kfl00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3208401..3209627
Genome map
AA seq 408 aa AA seqDB search
MNPRTVVILGSTGSVGTQALELIARNRDRFRVHAISAGGDNVGLLARQALEFEVEVVAVA
RATVAQDLQLAFYAEAQRRGYAQGEFRIPKILTGPDASSELAAMPCDVVLNGITGSLGLR
PTLAALDAGNTLALANKESLVIGGPLVTRRVKPGQIVPVDSEHSAIAQCLRGGSGDEVRK
LLLTASGGPFLGRARSELAEVTVEQALEHPNFAMGPVVTINSATLVNKGLELIEAHLLFG
LPMDRIDVVVHPQQAVHSMVEFYDGSTLAQVGLPTMTVPIALGLGWPDRIPDASPPWNWA
EASTWQFLPLDDEAFPSVQLAREAGARGGTAPAVFNAANEVCVQAFRDGRLPFLAIVDTV
ARVVTDHDVPSYEELSIDDVLAADAWARSRARELTAGGNDNGQETTQA
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
gtgaatccgcgtaccgtcgtcatcctcggctcgaccggctccgtcggcacccaggcgctg
gagctgatcgcccgcaaccgcgaccggttccgggtccacgcgatctcggcgggcggcgac
aacgtcggcctgctggcccggcaggcgctggagttcgaggtcgaggtggtcgcggtcgcc
agggccaccgtcgcccaggacctgcagctcgcgttctacgccgaggcgcagcgccgcggc
tacgcgcagggcgagttccggatcccgaagatcctgaccggcccggacgcctccagcgag
ctcgcggcgatgccgtgcgacgtggtgctcaacggcatcaccgggtcgctcggcctgcgc
ccgacgctggccgccctggacgccggcaacaccctcgcgctggccaacaaggagtccctc
gtcatcggcgggccgctggtcacccgccgggtcaagccggggcagatcgtgccggtcgac
tccgagcacagcgcgatcgcccagtgcctgcgcggcggcagcggcgacgaggtccgcaaa
ctgctgctgaccgccagcggcggcccgttcctcggccgcgcccgcagcgagctggccgag
gtgaccgtcgagcaggcgctggagcaccccaacttcgcgatgggcccggtcgtcacgatc
aactccgccaccctggtgaacaaggggctcgagctgatcgaggcgcacctgctgttcggc
ctcccgatggaccggatcgacgtcgtggtgcacccgcagcaggcggtgcactcgatggtc
gagttctacgacgggtccacgctggcccaggtcggcctgccgacgatgacggtgccgatc
gcgctcggcctgggctggcccgaccggataccggacgcctcgccgccgtggaactgggcc
gaggcgagcacctggcagttcctgccgctcgacgacgaggcctttccctcggtccagctg
gcccgcgaggccggcgcccgcggcggcaccgccccggcggtgttcaacgcggcgaacgag
gtctgcgtgcaggcgttccgggacggccggctgccgttcctggcgatcgtcgacaccgtc
gcccgggtggtgaccgatcacgacgtaccctcgtacgaggaactgtccatcgacgacgtg
ctcgccgcggacgcctgggcacggtcccgggcccgtgagctcaccgccggcggcaacgac
aacggccaggagaccacacaggcatga

DBGET integrated database retrieval system