KEGG   Kribbella flavida: Kfla_3065Help
Entry
Kfla_3065         CDS       T01155                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
kfl  Kribbella flavida
Pathway
kfl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
kfl01100  Metabolic pathways
kfl01110  Biosynthesis of secondary metabolites
kfl01130  Biosynthesis of antibiotics
kfl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Kfla_3065
Enzymes [BR:kfl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Kfla_3065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh NanE PEP_hydrolase DHO_dh
Motif
Other DBs
NCBI-ProteinID: ADB32129
UniProt: D2Q304
Position
3262251..3263057
Genome map
AA seq 268 aa AA seqDB search
MTVLDDILAGVREDLAERQALVSLDDLKLEAQRKPDAKDPMPVFRGDGIAVIAEVKRSSP
SKGELAEISDPAALASEYEQGGAAAISVLTEKRRFGGSLEDLRAVRGQVDVPVLRKDFVV
SSYQLWEARAAGADMVLLIVAALEQEALVSLIERAHSIGLCPLVEVHDEEETRRAVDAGA
QLIGVNNRNLKTLAVDRSTFARVAPVIPSNLVRVAESGVRGPHDVIEFARAGADVVLVGE
TLVTGSDPRSSVADLVAAGSHPAIQQRH
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgactgtgcttgacgacattctcgccggggtccgggaggacctcgcggagcgccaggcg
ctggtcagcctggacgacctgaagctggaggcgcagcgcaagcccgacgcgaaggacccg
atgccggtgttccgtggcgacgggatcgcggtgatcgccgaggtgaagcggtccagcccg
tccaagggcgagctggccgagatctccgacccggccgcgctggcctcggagtacgagcag
ggcggggcggccgcgatctcggtgctgaccgagaagcggcgcttcggcggcagcctggag
gacctgcgcgcggtgcgcggccaggtcgacgtgccggtgctgcgcaaggacttcgtggtg
tcttcctaccagttgtgggaggcccgcgcggccggtgccgacatggtgctgctgatcgtg
gcggcgctggagcaggaggcgctggtctcgctgatcgagcgggcccactcgatcggcctg
tgcccgctggtcgaggtgcacgacgaggaggagacccggcgcgcggtcgacgccggcgcc
cagctgatcggcgtgaacaaccgcaacctgaagacgctcgcggtcgaccgcagcacgttc
gcccgggtggcgccggtgatcccgtccaacctggtccgggtggcggagtcgggcgtgcgc
ggcccgcatgatgtaatcgagttcgcgcgcgccggggccgatgtcgtcctcgtcggtgaa
accctggtgaccggcagcgatccccgctcctcggtcgccgatctggtcgctgccggatcg
caccccgccatccagcagcgtcactga

DBGET integrated database retrieval system