KEGG   Kribbella flavida: Kfla_3065Help
Entry
Kfla_3065         CDS       T01155                                 

Definition
Indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
kfl  Kribbella flavida
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Kfla_3065
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Kfla_3065
Enzymes [BR:kfl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Kfla_3065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3262251..3263057
Genome map
AA seq 268 aa AA seqDB search
MTVLDDILAGVREDLAERQALVSLDDLKLEAQRKPDAKDPMPVFRGDGIAVIAEVKRSSP
SKGELAEISDPAALASEYEQGGAAAISVLTEKRRFGGSLEDLRAVRGQVDVPVLRKDFVV
SSYQLWEARAAGADMVLLIVAALEQEALVSLIERAHSIGLCPLVEVHDEEETRRAVDAGA
QLIGVNNRNLKTLAVDRSTFARVAPVIPSNLVRVAESGVRGPHDVIEFARAGADVVLVGE
TLVTGSDPRSSVADLVAAGSHPAIQQRH
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgactgtgcttgacgacattctcgccggggtccgggaggacctcgcggagcgccaggcg
ctggtcagcctggacgacctgaagctggaggcgcagcgcaagcccgacgcgaaggacccg
atgccggtgttccgtggcgacgggatcgcggtgatcgccgaggtgaagcggtccagcccg
tccaagggcgagctggccgagatctccgacccggccgcgctggcctcggagtacgagcag
ggcggggcggccgcgatctcggtgctgaccgagaagcggcgcttcggcggcagcctggag
gacctgcgcgcggtgcgcggccaggtcgacgtgccggtgctgcgcaaggacttcgtggtg
tcttcctaccagttgtgggaggcccgcgcggccggtgccgacatggtgctgctgatcgtg
gcggcgctggagcaggaggcgctggtctcgctgatcgagcgggcccactcgatcggcctg
tgcccgctggtcgaggtgcacgacgaggaggagacccggcgcgcggtcgacgccggcgcc
cagctgatcggcgtgaacaaccgcaacctgaagacgctcgcggtcgaccgcagcacgttc
gcccgggtggcgccggtgatcccgtccaacctggtccgggtggcggagtcgggcgtgcgc
ggcccgcatgatgtaatcgagttcgcgcgcgccggggccgatgtcgtcctcgtcggtgaa
accctggtgaccggcagcgatccccgctcctcggtcgccgatctggtcgctgccggatcg
caccccgccatccagcagcgtcactga

DBGET integrated database retrieval system