KEGG   Kribbella flavida: Kfla_3066Help
Entry
Kfla_3066         CDS       T01155                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
kfl  Kribbella flavida
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Kfla_3066
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Kfla_3066
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Kfla_3066
Enzymes [BR:kfl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Kfla_3066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3263167..3264378
Genome map
AA seq 403 aa AA seqDB search
MTTLLPDQLGHFGRFGGRFMPEALIGPLDELTAAWQNAMADKTFTDEFERMLREYAGTPS
LLYDATRLSDVAGARILLKREDLNHTGAHKIRNVLGQALLTKRMGKSRVIAETGAGQHGV
ATATACAYLDLECVVYMGEVDTERQALNVARMKLLGAEVIPVKTGSRTLKDAINEALRDW
VASVDNTHYLLGTAAGGHPFPAMVRDFVRGIGDEARAQSLELLGRLPDAAIACVGGGSNA
IGLFAAFVPDTDVKLYGIEAGGDGYDTGRHAATITAGQIGVLHGARSYLLQDDDGQTIES
HSISAGLDYPGVGPEHAWLAETGRAAYRPVTDAAAMEALRLLARTEGIIPAIESAHAIAG
ALEVARELGPEAVLLVNLSGRGDKDMDTAGEWFGLIDAKDLQA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaccacactgctgcccgaccagctcgggcacttcggccgtttcggcggccggttcatg
ccggaggctctgatcggcccgctggacgagctgacggccgcctggcagaacgcgatggcc
gacaagaccttcaccgacgagttcgagcggatgctgcgcgagtacgccggcaccccgagc
ctgctgtacgacgcgacccggctgtccgacgtcgccggcgcccggatcctgctcaagcgc
gaggacctcaaccacaccggcgcccacaagatccgcaacgtgctcggccaggcgctgctg
accaagcggatgggcaagtcccgggtgatcgccgagaccggcgccggtcagcacggcgtc
gccaccgcgaccgcctgcgcctacctcgacctcgagtgcgtggtctacatgggcgaggtc
gacaccgagcggcaggccctcaacgtcgcccggatgaagctgctcggcgccgaggtgatc
ccggtcaagaccggcagccggacgctgaaggacgccatcaacgaggcgctgcgcgactgg
gtcgccagcgtcgacaacacccactacctgctcgggacggcggccggcggccacccgttc
ccggcgatggtgcgcgacttcgtccgcggcatcggcgacgaggcccgggcccagtcgctg
gagctgctcggccggctgcccgacgccgcgatcgcctgcgtcggcggcggctcgaacgcg
atcggcctgttcgccgccttcgtaccggacaccgacgtcaagctgtacggcatcgaggcc
ggcggcgacggctacgacaccggccggcacgcggcgacgatcacggccggccagatcggc
gtgctgcacggcgcccggtcctacctgctgcaggacgacgacgggcagaccatcgagtcg
cactcgatctcggccgggctggactaccccggcgtcggcccggagcacgcctggctggcc
gagaccggccgggcggcgtaccggccggtgacggacgcggccgcgatggaggcgctgcgg
ctgctggcccggaccgagggcatcattcccgcgatcgagtccgcgcacgccatcgccggt
gcgctggaggtcgcccgcgagctcggtccggaggctgtgctgctggtgaacctgtccggc
cgcggcgacaaggacatggacaccgccggcgagtggttcggcctgatcgacgcgaaggac
ctgcaggcatga

DBGET integrated database retrieval system