KEGG   Kribbella flavida: Kfla_3067Help
Entry
Kfla_3067         CDS       T01155                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
kfl  Kribbella flavida
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Kfla_3067
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Kfla_3067
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Kfla_3067
Enzymes [BR:kfl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Kfla_3067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3264375..3265199
Genome map
AA seq 274 aa AA seqDB search
MNEVIALGNAGRAIRKARDEGRAALVGYLPAGYPTLGDGVDGLKALVDGGADVLEIGLPY
SDPVMDGVTIQRATETALAGGLRTRDVLATVEQVAAYSDVPVLVMTYWNPIERYGVDRFA
TDLAAAGGAGLITPDLIPEEGAEWIAAADKLDLDKVFLVSPSSTDSRIALTTANCRGFVY
ATAVMGVTGAREQASDLAAPLVARTKATTALPVGVGLGVSNADQAAGIAAFADAVIVGAA
LVKAMGDGGPTGVRTLTESLAEGVRREPTAVAGR
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaggtgattgccctcggcaacgcggggcgcgcgatccggaaggcccgcgacgag
ggccgcgccgcgctggtcggctacctgccggccggctacccgacgctcggtgacggggtg
gacgggctgaaggcgctggtcgacggtggagccgacgtgctcgagatcggcctgccgtac
agcgacccggtgatggacggcgtgacgatccagcgcgccaccgagaccgccctggccggt
ggcctgcgcacccgcgacgtgctcgccacggtcgagcaggtcgcggcgtactccgacgta
ccggtgctggtgatgacgtactggaacccgatcgagcggtacggcgtcgaccggttcgcc
accgatctggccgcggccgggggagcggggctgatcacgcccgacctgatccccgaggaa
ggcgcggagtggatcgcggcggccgacaagctggacctggacaaggtgttcctggtctca
ccgtcgtccaccgactcccggatcgcgctgaccacggcgaactgccggggcttcgtctac
gcgaccgcggtgatgggggtcaccggtgcccgcgagcaggcctccgacctggccgcgccg
ctggtcgcccggaccaaggcgaccaccgcgctgccggtcggtgtcggcctcggcgtctcc
aacgccgaccaggccgccggcatcgcggcgttcgcggacgcggtgatcgtcggagcggcg
ctggtgaaggcgatgggcgacggcgggccgaccggcgtccggacgctgaccgaaagtctg
gccgagggcgtacgacgggaaccgacggccgtcgccggtcgttag

DBGET integrated database retrieval system