KEGG   Kribbella flavida: Kfla_3125Help
Entry
Kfla_3125         CDS       T01155                                 

Definition
von Willebrand factor type A
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
kfl  Kribbella flavida
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Kfla_3125
Enzymes [BR:kfl01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Kfla_3125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3341632..3344145
Genome map
AA seq 837 aa AA seqDB search
MRPAPNQPGEAGQPLPTPPASTGFPFTAVVGMEDLQLALVLAAVSPAIGGVLIRGEKGTA
KSTAVRALTEILPPVEVIPGCRFSCAPTAPDPICPDGPHPPYTPAAPETAPTGYAGDPAT
TSPETALSGARSASAGDAAAGSRETALSGARSASAGDAAAGSRETTLSAAQPAYADDLAA
GMSGDRSAAPTAFSASRSAAGAGSGAVSRPARLVELPVGATEDRVLGSLHLERALAEGVT
AYEPGLLAAAHRGILYVDEVNLLHDHLVDVLLDAAAMSRATVERDGVSITHPARFVLVGT
MNPEEGELRPQLLDRFGLTVDVVASRDPAVRVEVMRARLTYEADPAAFVRRYDAAQRELA
ERIVKAQSLLPDVILTDPALRQIAEICAAFDVDGMRADLVTARTAVAHAAWSGRTVVEVE
DVRAAAKLALPHRTRRNPFDAPGLDQDRLEQAISDSTPPDDPDDDPDGGAPGRPDGGPNS
DGDPSGDGSPDDARDPGARDPDARDSDLTADRDANGSAPGDRAPDGGLSDSPADGNPQRV
RGNGSAENTGDPENALSGDAPTGDVATSSTPYKARLLSVQSAGPGVAGRRSRAITEVGRV
VGDRARVGRESGRPHLLATLRAAAPHQHSRGRSGPGLAVHPTDVRLGVREGREGNLVLFC
VDASGSMGTKRRMSEVKTAIVSLLLDAYQRRDKVGLVTFARSQATVALPPTGSVETAVRR
LESLPTGGRTPLAEGLVRAADVLRIAAIRDPRRRPLLVLVTDGRATHGESAFSRARQAAE
WIGHQGIAAVVVDCEPRRGVRLGLAAELATSLRAEYLDLGEVAAGNLVQAVTTRSAA
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atgcggcctgctccgaaccagcccggtgaagccggacaacctcttcccaccccgccggcg
tcgacgggtttcccgttcaccgcggtggtggggatggaggacctccagctcgccctcgtg
ctcgcggcggtctcacccgcgatcggcggcgtgctgatccgcggcgagaagggcaccgcc
aagtccaccgccgtccgggccctcaccgagatcctcccgccggtcgaggtgattcccggc
tgccgcttctcctgcgcccctaccgcccccgaccccatctgccccgacggccctcacccg
ccgtacaccccggccgccccggaaaccgctcccaccgggtacgccggagatcccgcgacc
acctcgccggagaccgctctctccggcgcgcgttcggcgtccgccggggatgccgcggcc
ggctcccgggagaccgctctctccggcgcgcgttcggcgtccgccggggatgccgcagcc
ggctcccgggagaccactctctccgcggcgcagccggcgtacgctgacgacctcgcggcg
ggcatgtccggagaccgttccgccgcgcccaccgcgttctcggcctcgcgttccgccgcg
ggcgcaggctctggcgcggtctcccggccggctcggttggtggagctgccggtcggggct
accgaggaccgggtgctcgggtcgctgcacctggagcgggcgctggccgagggcgtgacg
gcgtacgagccggggctgctggcggcggcgcaccgcgggatcctgtacgtcgacgaggtc
aacctcctgcacgaccacctggtcgacgtgctgctcgacgccgccgcgatgagccgggcg
acggtggaacgcgacggcgtctccatcacccaccccgcccgcttcgtgctggtcggcacc
atgaacccggaggagggcgagctccgcccccagctcctggaccggttcggcctgaccgtc
gacgtcgtcgccagccgcgaccccgccgttcgtgtcgaggtgatgcgtgctcgcctcacc
tacgaggccgatcctgccgccttcgtccgccggtacgacgcggcgcagcgcgagctggcc
gagcggatcgtcaaggcgcaaagcctgctgcccgacgtgatcctgaccgacccggcgctg
cggcagatcgccgagatctgcgcggcgttcgacgtcgacgggatgcgcgccgacctggtc
accgcccggacggccgtggcgcacgcggcctggtccgggcgcacggtcgtcgaggtcgag
gacgtccgcgccgcggcgaagctggccctgccgcaccgcacccggcgcaacccgttcgac
gccccgggactggatcaggaccgcctcgagcaagcgatcagcgacagcaccccgccggac
gacccggacgacgaccccgacggcggcgcccctggccgtcccgacggtggcccgaacagc
gacggcgatccgagcggcgacggcagcccggacgacgcccgtgacccgggggcccgcgat
cccgatgctcgcgactccgacctcaccgcggaccgcgacgccaatggctccgccccaggt
gatcgcgccccggacggtggcttgagcgattccccggccgacggcaacccgcagcgcgtc
cgcggcaacggctcggcagagaacaccggagatccggagaacgcgctctccggtgacgct
ccgaccggcgacgtggcgaccagttccacgccgtacaaggcacggttgctcagcgtccag
tcggccggtccgggcgtcgcgggtcgtcgctcccgggcgatcaccgaggtcggccgggtg
gtcggcgaccgggcgcgggtcggccgcgagtccggtcgcccccacctcctcgccacgctc
cgcgccgcggcgccgcaccagcattcccggggccggtccggcccgggcctcgccgtccat
ccgaccgacgtccgcctgggcgtccgcgagggccgcgaaggcaatctggtgctgttctgt
gtcgacgcgtccggctcgatgggcacgaagcggcggatgagcgaggtgaagaccgcgatc
gtgtcgttgctgctcgacgcctaccagcggcgcgacaaggtcggcctggtcacgttcgcg
cgcagccaggcgaccgtcgcgcttccgccgaccggcagcgtcgagaccgccgtgcgccgg
ctggagtcgctgcccacgggcggaaggacgccgctggcggaagggctggtccgggcggcc
gacgtactgcggatcgccgcgatccgtgatccccggcgccggccgttgctggtgctggtc
accgacgggcgggcgacgcacggagagagcgcgttctcgcgggcccggcaggcggccgag
tggatcgggcaccagggcatcgccgccgtcgtcgtggactgcgagccgcgccggggcgtc
cgcctcggtctcgccgccgagctcgcgaccagcctgcgcgccgagtacctcgacctcggc
gaagttgccgcgggcaacctggtccaggccgtcaccacccgcagcgccgcatga

DBGET integrated database retrieval system