KEGG   Kribbella flavida: Kfla_3196Help
Entry
Kfla_3196         CDS       T01155                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
kfl  Kribbella flavida
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Kfla_3196
Enzymes [BR:kfl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Kfla_3196
Exosome [BR:kfl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Kfla_3196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3411101..3412618
Genome map
AA seq 505 aa AA seqDB search
MADFVGAVDQGTTSTRFMIFDHSGNEVGKHQLEHQQILPQAGWVEHNPVEIWERTASVIR
TAMNAQGLQSSDLAALGITNQRETAVVWNRKTGRPYYNAIVWQDTRTDRIASALEREGKG
DVIRQKAGLPPATYFSAGKVQWILDNVDGVREAAEAGDAVFGNTDTWLLWNLTGGTEGGV
HITDVTNASRTMLMNLETLDWDDELISFFNIPRQMLPEIRPSSDPNKYGETLARGPLGGV
VPLTGDLGDQQAATVGQVCFNPGEAKNTYGTGNFMLLNTGTELVRSKAGLLSTMAYKFGD
DAPVYALEGSIAVTGSAVQWLRDQLGIISGASETETLARQVKDNGGVYFVPAFSGLFAPY
WRSDARGAIVGLSRFNTNAHLARATLEAICYQSKDVADAMEKDSGVKLEVLKVDGGVTAN
ELCMQMQADILGVPVSKPVVAETTALGAAYAAGLAVGFWNNTDELVQNWNEDKRWNPEWN
DEQRADGYKGWEKAVRRTLDWVDVD
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggctgacttcgtcggcgccgtcgaccagggcaccacgagcacccgcttcatgatcttc
gaccactccggcaacgaggtgggcaagcaccagctggagcaccagcagatcctgccgcag
gccggctgggtcgagcacaacccggtggagatctgggagcggaccgcctcggtgatccgg
accgcgatgaacgcgcagggactgcagtcgagcgacctggcggcgctcggcatcaccaac
cagcgcgagaccgccgtggtctggaaccgcaagaccggccggccgtactacaacgcgatc
gtctggcaggacacccggaccgaccggatcgcctccgcgctggagcgggagggcaagggc
gacgtcatccggcagaaggccgggctgccgccggccacgtacttctcggccggcaaggtg
cagtggatcctggacaacgtcgacggcgtccgcgaggcggccgaggccggtgacgccgtc
ttcggcaacaccgacacctggctgctgtggaacctcaccggcggcaccgagggcggcgtg
cacatcaccgacgtcaccaacgccagccgcacgatgctgatgaacctggagacgctcgac
tgggacgacgagctgatctcgttcttcaacatcccgcggcagatgctgccggagatccgg
ccgtcgtcggacccgaacaagtacggcgagacgctggcccgcggtccgctcggcggcgtc
gtaccgctgaccggggacctcggcgaccagcaggcggcgaccgtcggccaggtctgcttc
aaccccggcgaggcgaagaacacctacggcaccggcaacttcatgctgctgaacaccggc
accgagctggtccgctcgaaggcgggtctgctcagcacgatggcctacaagttcggcgac
gacgcgccggtctacgcgctcgagggctcgatcgccgtcaccggctcggccgtccagtgg
ctgcgtgaccagctcggcatcatctccggcgcgagcgagaccgagacgctggcccggcag
gtcaaggacaacggcggcgtgtacttcgtgccggcgttctccggcctgttcgcgccgtac
tggcgctccgacgcgcgcggcgcgatcgtcgggctgtcgcggttcaacaccaacgctcac
ctggcccgcgcaacactggaagcgatctgttaccagagcaaggacgtcgccgacgcgatg
gagaaggactcgggcgtcaagctggaggtcctcaaggtcgacggcggggtgacggcgaac
gagctgtgcatgcagatgcaggccgacatcctcggcgtgccggtgagcaagccggtcgtc
gcggagacgacggcgctcggcgcggcgtacgcggcggggctggcggtcgggttctggaac
aacaccgacgagctggtgcagaactggaacgaggacaagcgctggaacccggagtggaac
gacgagcagcgggccgacgggtacaagggctgggagaaggccgtccggcggacgctcgac
tgggtcgacgtcgactag

DBGET integrated database retrieval system