KEGG   Kribbella flavida: Kfla_3263Help
Entry
Kfla_3263         CDS       T01155                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
kfl  Kribbella flavida
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Kfla_3263
   01230 Biosynthesis of amino acids
    Kfla_3263
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kfla_3263
   00051 Fructose and mannose metabolism
    Kfla_3263
   00562 Inositol phosphate metabolism
    Kfla_3263
Enzymes [BR:kfl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Kfla_3263
Exosome [BR:kfl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Kfla_3263
  Exosomal proteins of bladder cancer cells
   Kfla_3263
  Exosomal proteins of melanoma cells
   Kfla_3263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3492121..3492939
Genome map
AA seq 272 aa AA seqDB search
MAGSEISAARTPLMAGNWKMNVNHVEAVHLLQKLSWTLQDKKHDFERVEVAVLPPFTDIR
SVQTLVDGDRMKIVYGAQDVSVHDEGAYTGEISAAMLTKLGCTYVLAGHSERRQYHGEDD
ALVNAKATKALAAGLVPIVCVGEGLEVRKAGEHVAHTLAQVDGALAGLKPDDVRKVVIAY
EPVWAIGTGEVATPEDAQEVCAAIRGRLEESISPAVADAVRILYGGSVKMSSAGGIMSQP
DVDGCLVGGASLKVDEFAGICRYLDLQLGYSS
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggctggctctgagatttcggctgctcgtacgccgttgatggcgggcaactggaagatg
aacgtcaaccacgtcgaggccgtgcacctgctgcagaagctgagctggacgctgcaggac
aagaagcacgacttcgagcgggtcgaggtcgcggtgctgccgccgttcaccgacatccgc
agcgtgcagacgctcgtcgacggcgaccggatgaagatcgtgtacggcgcgcaggacgtg
tcggtgcacgacgagggcgcctacaccggcgagatctcggcggcgatgctgaccaagctc
ggctgcacctacgtgctggccggtcactccgagcgccggcagtaccacggcgaggacgac
gcgctggtgaacgccaaggccaccaaggcgctggcggccgggctcgtcccgatcgtctgc
gtcggcgagggcctcgaggtccgtaaggccggcgagcacgtcgcgcacacgctggcccag
gtcgacggcgcgctggccgggctcaagccggacgacgtgcgcaaggtcgtcatcgcctac
gagccggtgtgggcgatcggcaccggcgaggtggccacacccgaggacgcgcaggaggtc
tgcgccgcgatccggggccggctggaggagtcgatctcacccgccgtggccgacgcggta
cggattctgtacggggggtcggtgaagatgagcagcgcaggtggcatcatgtcccagccg
gacgtcgacggctgcctggtcgggggtgcgagcctcaaggtggacgagttcgccggtatc
tgccgttacctggaccttcagttaggctactcctcgtga

DBGET integrated database retrieval system