KEGG   Kribbella flavida: Kfla_3660Help
Entry
Kfla_3660         CDS       T01155                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
kfl  Kribbella flavida
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Kfla_3660
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Kfla_3660
Enzymes [BR:kfl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Kfla_3660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3939985..3941610
Genome map
AA seq 541 aa AA seqDB search
MTRLARPRRQVILAGLAAAALLATPFTAPSSASALPTVSQQAGAPSAPALIPKPATQHAL
PGQTFALQPWSVVGLESSAAESRAAKKIADGLTTQLRRSTGYRLPVLPALPGLTDVKLST
NGPASLGAEGYRLRADRSVLSVVAATPEGLYRGVTTLRQLLPAKADAKTRQAGPWRISGT
SIADSPRYSYRGAMLDVSRHFFSVAEVKRYIDLASLYKLNKLHLHLSDDQGWRIQVDSWP
RLTTYGGSLEVGGTPGGSYSKAEYASLVQYAADHYMTVIPEIDTPGHTNAALASYAELNC
DGVAPPLYTGTSVGFSSLCVGKDLTYDFLGDVFREVAEQNPGDVLHLGGDEAHSTPHSDY
LTFVPKAAALVTQQGKRVMGWQEIAETPLPAGSIAQYWGTDDARSRELARKAAAQGAQVV
LSPANRAYLDMKYDASTPYGLSWAGLVSVQKSYEWNPSTLIPNLPESAIAGVEAPIWTET
LDDLDKLEYMAFPRLPGIAELGWSPASALDWTSYKDRLAGQGSRWDTLSVNFFRAPEIAW
R
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgacacgactcgcccgcccccgtcgtcaggtcatcctggccggtcttgccgcagccgcc
ctgctggcgactccattcaccgccccgagctcggcatcagccctgcccaccgtcagccag
caggcaggagcgccctctgctcccgctctgattccaaagcccgccactcagcacgctctg
ccgggtcagaccttcgcactgcagccctggagcgttgtcggcctcgagtcgagcgccgcc
gagagccgagcagccaagaagatcgccgacggcctcaccactcagctacgccgttccacc
ggctaccgattgccggtcctgcccgcattgcccgggctgaccgacgtgaagctctccacc
aacggcccagcctcactgggggccgagggctaccggctgcgcgccgaccgctcggtcctg
agcgtggtggcggcgactcctgagggtctctaccggggcgtgaccaccctgcgccagctc
ctgcccgccaaggccgacgcgaagacccggcaggccggcccctggcggatcagcggcacg
tcgatcgccgactcgccccgctacagctaccgcggagcgatgctcgacgtgtcccggcat
ttcttctccgtggcggaggtgaagcgctacatcgacctcgcctcgctctacaagctgaac
aagctccacctgcacctgtcggacgaccagggctggcggatccaggtggacagctggccc
cggctcacgacgtacggcggtagcctggaggtcggtggcacacccggcggctcctacagc
aaggcggagtacgccagcctggtccagtacgccgccgaccactacatgaccgtcatcccc
gagatcgacacccctggccacaccaacgcggccctagcctcgtacgccgaactgaactgc
gacggcgtcgctcccccgctctacaccgggaccagtgtcggcttcagctcgctgtgcgtc
ggcaaggacctcacctacgacttcctgggcgacgtgttccgcgaggtggccgagcagaac
cccggtgacgtgctgcacctcggcggtgacgaggcgcactcgaccccgcactcggactac
ctcacgttcgtgccgaaggcggcggcgctggtcacccagcagggcaagcgggtgatgggc
tggcaggagatcgccgagacaccgctcccggccggcagcatcgcgcagtactggggcacc
gacgacgcccgctcgcgggaactcgcccgcaaggccgcggcccagggcgcccaggtcgtg
ctgtccccggcgaaccgggcgtacctggacatgaagtacgacgccagtacgccgtacggg
ctgtcctgggccgggctggtcagcgtgcagaagtcgtacgagtggaacccgtcgacgctg
atccccaacctgccggagagcgcgatcgccggcgtcgaggcgccgatctggaccgagacg
ctggacgacctggacaagctcgagtacatggcgttcccccggctgccgggcatcgccgaa
ctcggctggtcgccggcctccgcgctggactggaccagctacaaggaccgcctggcaggt
cagggctcgcggtgggacaccctcagcgtgaacttcttccgggcgccggagatcgcctgg
cgctga

DBGET integrated database retrieval system