KEGG   Kribbella flavida: Kfla_4275Help
Entry
Kfla_4275         CDS       T01155                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
kfl  Kribbella flavida
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:kfl00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:kfl00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4603326..4604486)
Genome map
AA seq 386 aa AA seqDB search
MTGFTPSKADKFSFGLWTVGWEGVDVFGTAVRAPLDPVLAVEKLAELGAAAISFHDDDLV
PDDAQRRQVLERFTKALADTGMVVEMATTNLFAHPVFKDGGLTANDRDVRRYALAKVLRN
VDLAAELGATTYVLWGGREGSESGGSKDVGAALDRYKESMDLLTTYVREQGYDLRFALEP
KPNEPRGDILLPTIGHAIAFINDLEHPELVGINPEVGHEQMAGLNYAHGIAQALWHGKLF
HIDLNGQHGPRFDQDLRFGAGNLREAFWTVDVLQGSQGRPGYDGYVHFDYKPPRTEDLDG
VWETARGCMRNYLVLREKVAAFRADPEVAEALAAARVADLSEPTLGAGESLDDLRKASYD
PDALAQRGLGFERLDQLAMDHLLGIR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaccggttttaccccgagcaaggccgacaagttctccttcggcttgtggacggtcggc
tgggaaggcgtcgacgtcttcggtacggcggtccgcgcgccgctcgacccggtgctggcg
gtggagaagctggccgagctgggtgccgccgcgatctcgttccacgacgacgacctggtc
ccggacgacgcgcagcgccggcaggtgctcgagcggttcaccaaggcgctggccgacacc
gggatggtggtcgagatggccaccacgaacctgttcgcccacccggtgttcaaggacggc
ggcctgaccgcgaacgaccgcgacgtccgccggtacgcgctcgcgaaggtgctgcgcaac
gtcgacctggccgccgagctgggcgcgacgacgtacgtgctgtggggcggccgggagggc
tcggagtcgggcggttccaaggacgtcggcgccgcgctggaccggtacaaggagtcgatg
gacctgctcacgacgtacgtgcgcgagcagggctacgacctgcggttcgcactggagccg
aagccgaacgagccgcgcggcgacatcttgctgccgacgatcgggcacgcgatcgcgttc
atcaacgacctggagcaccccgagctggtcggcatcaaccccgaggtcgggcacgagcag
atggcggggctgaactacgcccacggcatcgcccaggcgctgtggcacggcaagctgttc
cacatcgacctgaacgggcagcacgggccgcggttcgaccaggacctgcgcttcggcgcc
ggcaacctgcgggaggcgttctggactgtggacgtgctgcagggctcgcagggccggccc
gggtacgacgggtacgtgcacttcgactacaagccgccgcgcaccgaggacctggacggc
gtctgggagaccgcgcgcggctgcatgcgcaactacctggtcctgcgggagaaggtggcc
gcgttccgggccgacccggaggtcgccgaggccctcgccgcggcgcgggtggccgacctg
tccgagccgacgctcggcgcgggggagtcgctcgacgacctgcgcaaggcgtcgtacgac
ccggacgcgctggctcagcggggcctcgggttcgagcggctcgaccagctcgcgatggat
cacctgctgggtattcgataa

DBGET integrated database retrieval system