KEGG   Kribbella flavida: Kfla_4334Help
Entry
Kfla_4334         CDS       T01155                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
kfl  Kribbella flavida
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Kfla_4334
Enzymes [BR:kfl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Kfla_4334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4672258..4672992)
Genome map
AA seq 244 aa AA seqDB search
MSRTEILADSLDTGVEMTKHRTPDTPAGHDAHRPADRATRDDAHTPGGDDGSGRPPARLT
VLAGPTAVGKGTVAAEIRERFPDVWISVSATTRKARPGEVHGVHYLFVSDDEFDRMIADG
ELLEWAVVHKAARYGTPKQPVLDKLAAGRPALLEIDLQGARQVRATMPEAHFVFLAPPSW
DELVRRLVGRGTETADERERRLETAVLELAAEKEFDVTIVNASVREAADQLVKLIRSPSI
SGKS
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
gtgagccggaccgaaatcctcgctgactcgttggacactggtgtggagatgaccaagcac
aggacacccgacacaccagccggccacgacgcccaccggccggccgaccgggccacgcgt
gacgatgcccacacgccgggcggcgacgacggctccggccggccgccggcgcggctgacc
gtgctggccggcccgaccgccgtcggcaagggcaccgtggccgcggagatccgcgagcgg
ttccccgacgtgtggatctcggtgtcggcgacgacgcgcaaggcgcggccgggcgaggtg
cacggcgtgcactacctgttcgtgtccgacgacgagttcgaccggatgatcgccgacggc
gagctgctggagtgggccgtcgtgcacaaggcggcccgctacggcaccccgaagcagccg
gtgctggacaagctggccgccggccgcccggcgctgctggagatcgacctgcagggcgcc
cgccaggtccgggcgacgatgccggaggcgcacttcgtcttcctggccccgccgagctgg
gacgaactggtccgccggctggtcggccgcggtaccgagacggccgacgagcgggagcgc
cggctggagaccgcggtgctcgagctggccgccgagaaggagttcgacgtgacgatcgtg
aacgcctcggttcgggaggcggccgatcagttggtaaagttgattcgatcaccctccatc
tctggaaagagctga

DBGET integrated database retrieval system