KEGG   Kribbella flavida: Kfla_4351Help
Entry
Kfla_4351         CDS       T01155                                 

Definition
Protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
kfl  Kribbella flavida
Brite
Enzymes [BR:kfl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Kfla_4351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4688255..4689475)
Genome map
AA seq 406 aa AA seqDB search
MSNDQRYVESLRAALTGSLADQGALSSEAVVAAFRTVPRHLFVPDAPVEVAYADDVVLMK
RDEAGVPISSVSQPSLVALMLEQTGVRRGHRVLEIGSGGYNAALLSELVGPEGEVTTIDI
DPDVTERARATLDAAGYERVRVARTDGQFGYPESAPFDRIIVTVTAGDIAPAWVDQLADG
GRIVVPLRLRGQTRSIGFDLERSPGSAGVLWSRSSVVCGFVSMQGAGAAHERLVEIEPDK
VALQLDADQVLEAVLLPGVLRETPEVRWSRVLLGREESFCQLDLWLASVFPGYCVLTATR
RAVKSRLVRPALRWGGSAVVRDATIGYLTSQPGPTKNAVEIGARAHGPDARRLAEELVAQ
VLRWDEERRGRPDPVFVVHPLGTPATDLPAGPHFTTRSRVITVLWD
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaacgatcagcggtacgtcgagtcgttgcgggcggcgttgaccgggtcgctggcc
gatcagggagcgctctccagcgaagcggtcgtggctgcgttcaggacggtgccacggcat
ctcttcgtgccggacgccccggtcgaggtcgcgtacgccgacgacgtggtgctgatgaag
cgcgacgaggcaggggtgccgatcagctcggtctcgcagccttcgctggtcgcgttgatg
ctggagcagaccggcgtgcggcgcggtcaccgcgtgctggagatcggctccggcgggtac
aacgcggcgctgctgagcgagttggtcgggccggaaggtgaggtcaccacgatcgacatc
gatccggacgtgaccgagcgggcgcgggcgacgctggatgcggccgggtacgagcgggtg
cgggtggcccggaccgacgggcagttcggatacccggagagcgctcccttcgaccggatc
atcgtcacggtgacggccggggacatcgctcccgcctgggtcgaccagctcgccgacggg
ggacgcatcgtcgtaccgctgcggctgcgggggcagacgcggtcgatcggtttcgacctg
gagcgatcgcctggttcggctggggtgctgtggagccgctcgagtgtcgtgtgcggcttc
gtctccatgcagggggcgggggccgcgcacgagcggttggtcgagatcgagccggacaag
gtcgccctgcagctggacgcggatcaggtgcttgaggccgtgctgctgccgggggtgctg
cgggagacgcccgaggtgcggtggtcgcgcgtgctgctggggcgcgaggagtcgttctgc
cagctcgacctgtggctggcgtcggtctttcccgggtactgcgtgctgaccgcgacgcgc
cgggcggtgaagagccggttggtacgaccggccttgcggtggggcgggtcggcggtcgtc
cgggatgcgacgatcggctatctcacttcccagcccgggccgacgaagaatgcggtggag
atcggcgcacgagcgcacggaccggacgcccggcggctcgccgaagagctggtcgcgcag
gtccttcgctgggacgaggagcgacggggacggccggatccggtgttcgtcgtacacccc
ctcggaactcctgccaccgacctgcccgccggcccgcacttcaccacccgcagccgcgtc
atcacggtgctttgggattga

DBGET integrated database retrieval system