KEGG   Kribbella flavida: Kfla_4469Help
Entry
Kfla_4469         CDS       T01155                                 

Definition
Arginase/agmatinase/formiminoglutamase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
kfl  Kribbella flavida
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Kfla_4469
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Kfla_4469
Enzymes [BR:kfl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Kfla_4469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4818286..4819098
Genome map
AA seq 270 aa AA seqDB search
MTTVLCVPQWQGSGLGDSPRLAAGAHRTAELVPADSRITVPVLDTGGKPDAGVRGLDVLT
TNLRLTYDALTQIDDDVVITTGGDCAVDLAPIALARLRYGDRLTVLWIDAHPDLYTPQTL
RSGSFHGMVLRTLLGEGPAALVPAQPLVPEQVIIAGERAGSPSEHEYLERAGIRRYGVDT
FGQALDGVTGPVYLHIDLDVLEPTEFGSLGYPEPDGVRVDQLIELVSGADHVIGAAITEH
MPTGQATDEADSEVIRRLTAALCSRLDHQA
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgacaacagtgctgtgcgtaccgcagtggcaaggttcaggtctcggcgactcaccgcgg
ctcgcagccggcgcccaccgaaccgccgagctggttcccgccgacagccgcatcacggtg
ccggtgctcgacaccggcggcaaaccggacgccggcgtacgaggtctcgacgtactgacc
acgaacctgcgactgacctacgacgcgctgacgcagatcgacgacgacgtcgtgatcacc
accggcggcgactgcgcggtcgacctcgcaccgatcgccctggctcgactccggtacggc
gatcggctgaccgtgctctggatcgacgcacaccccgacctgtacacaccccaaacgctc
cgctcgggctccttccacggaatggtgctgcgcactctcctgggcgaggggccggccgca
ctggttccggcgcagccgctggttcccgagcaggtgatcatcgccggcgagcgcgccgga
agcccgtccgagcacgagtacctcgaacgtgccggcatccgccggtacggcgtcgacacc
ttcggccaggcgttggacggtgtcaccggtcctgtctacctgcacatcgacctggacgtc
ctggaaccgaccgagttcggttctctgggctatcccgagccggacggcgtacgggtcgac
cagctgatcgagctcgtctccggcgccgaccacgtcatcggtgccgccatcaccgagcac
atgccgacggggcaagcgacggacgaggccgactccgaggtcatccgccgcctgacggcc
gcgctctgctcgcgactcgaccaccaggcctga

DBGET integrated database retrieval system