KEGG   Kribbella flavida: Kfla_4566Help
Entry
Kfla_4566         CDS       T01155                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
kfl  Kribbella flavida
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Kfla_4566
Enzymes [BR:kfl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Kfla_4566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4914885..4915793)
Genome map
AA seq 302 aa AA seqDB search
MPEVVPEVGAEVVVVGSANVDLVLPVQRIPRPGETVLATGLTRGPGGKGANQAVASARAG
ASTAFVAALGDDDGGALLRAALAEAGVDLSLLQISQAPTGTAIITVDGAGENAITVAPSA
NATLRLTPAARSAVAGAKIVLSQLEIGFGTVQAAAEASAYFILNAAPAAELTDELLGQVD
LLVVNETEAEAVAGTKLSALLDRVPAAVVTLGAEGALILTRDAAEVRVPAVPVEVVDTTA
AGDTFCGVLAATLAATSTTASDLTNAVRRATVAASLSVQTAGAIPSVPHGESIDARCAEV
YL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgaggtcgtgcccgaggttggtgccgaggtcgtggtggtcggcagcgcgaacgtg
gacctggtgcttccggtccagcggatcccgcgacccggcgagacggtactggcgaccgga
ctgacccgcggcccgggcggcaagggcgcgaaccaggcggtcgcctcggcccgggcgggt
gcctcgaccgcgttcgtcgccgcgctcggcgacgacgacggcggcgctctgctgcgcgct
gcgctcgcggaggccggcgtcgacctgtcgttgctacagatttcgcaggcgccgaccggt
acggcgatcatcaccgtcgacggcgcgggggagaacgcgatcaccgtcgcgccgtccgcg
aacgccacgctgcggctgacgcccgcggcccggtccgcagtggccggagcgaaaatagtc
ctttcccaactcgagatcggtttcggtacggtgcaggcggcggcggaggcgagcgcgtac
ttcatcctgaacgcggcgcccgcggccgagctgaccgacgagttgctggggcaggtcgac
ctgctggtcgtgaacgagacggaggccgaggccgtggcgggaacgaagctgtccgcactg
ctggaccgggtgccggccgccgtggtcacgctcggcgccgagggcgcgctgatcctgacc
cgggacgcggccgaggtacgggtgccggcggtcccggtcgaggtggtcgacaccaccgcc
gcgggcgacaccttctgcggcgtgctggccgcgacgctggctgcgacatcaactacagcg
agcgacctgacgaatgcggtccgacgcgctaccgtagctgcttcattgagtgtccagacc
gcgggggcgatcccttcggtacctcacggggaatctatcgacgcgcgctgtgcggaggtg
tacctgtga

DBGET integrated database retrieval system