KEGG   Kribbella flavida: Kfla_4703Help
Entry
Kfla_4703         CDS       T01155                                 

Definition
Peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
kfl  Kribbella flavida
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:kfl00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:kfl00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5070918..5071430
Genome map
AA seq 170 aa AA seqDB search
MTTVYDFSAQRIEGNEQSLADFRDQVLLVVNTASQCSQTPQYSGLQKLYKTYRKQGFSVL
GFPCDQFGHQEPGDENEIANFCSTIYHVTFPMFAKIDVNGSKTLPLYNWLKREAGGLLGG
RIKWNFTKFLIGRDGQVIARYAPANTPEKLAGKIEAALAVPAPSRRDSGD
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgacgactgtctatgacttcagtgcccaacggatcgaaggcaatgaacagtctcttgcc
gacttccgcgaccaggtgctcctggtggtgaacaccgcctcgcagtgcagccagacgccg
cagtacagcggtctgcagaagctctacaagacgtaccgcaaacaaggcttctcagtgctc
ggctttccctgcgaccagttcggccaccaggagcccggtgacgagaacgagatcgcgaac
ttctgctcgacgatctaccacgtgacgtttccgatgttcgccaagatcgacgtgaacggg
tcgaagacgctgccgctgtacaactggctcaagcgcgaggccggtggactgctcggcggg
cggatcaagtggaacttcaccaaattcctgatcggtcgcgacggccaggtgatcgcccgg
tacgcgccggcgaacacgccggaaaagctcgccggcaagatcgaggcggcgctcgcggtt
ccggccccgagcaggcgcgattccggcgactga

DBGET integrated database retrieval system