KEGG   Kribbella flavida: Kfla_4777Help
Entry
Kfla_4777         CDS       T01155                                 

Definition
Arginase/agmatinase/formiminoglutamase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
kfl  Kribbella flavida
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:kfl01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:kfl00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5149402..5150274
Genome map
AA seq 290 aa AA seqDB search
MLDGPSNLGLRPPVVGAVPGCYKLAGAVRDQGFVGRVGARDAGCVTPPRYDRGDWQPGDG
VFNAAAMAGYSVRVAERVGRLVDEGNFVVLLGGECSNLLGPAVALRRRGRFGVVYLDGHS
DFRTVDNSPYVGAAGGEALALVTGRGQADLTDLESLRPYVRDTDAALLGIRDDDEYEPDV
RAAGIPVWPARDIIGDPAKAARGVLERMERDELDGFWVHLDVDILDAEVMPAVDSPDPGG
LQHQELQDLLEPLLASTQCAGIDIGIFDPDLDPDGKYAAELTDTLVAALT
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtgctggacgggccgtccaacttgggcttgcggccgccggtggtgggggcggtgccgggg
tgttacaagttggcgggggcggtgcgggatcaggggttcgtggggcgggtcggggctcgg
gatgcggggtgtgtgacaccgcctcggtacgaccgcggggactggcagccgggggacggg
gtgttcaacgcggcggcgatggcggggtacagcgtgcgggtggcggagcgggtcggccgg
ttggttgatgaaggcaacttcgtggtgctgctgggtggggagtgcagcaacctgctcggg
ccggcggtggcgttgcggcggcggggacggttcggagtggtctacctggacgggcactcc
gacttccggaccgtcgacaactcgccgtacgtcggcgcggcgggtggggaggcgctggcg
ctggtgacgggccgtgggcaggcggatctgacggatctggagtcgctgcggccctacgtg
cgggacacggatgcggcgctgctcgggatccgggacgacgacgagtacgagccggacgtg
cgagcggccgggatccccgtgtggccggcgcgggacatcatcggggatccggcgaaggcg
gcgcgtggagtgctcgagcggatggagcgcgacgagctggacgggttctgggtgcacctg
gacgtggacatcctggacgccgaggtgatgccggcggtcgacagtcccgatccgggtggg
ctgcagcatcaggagctgcaggacctgctcgagccgctcctggcctcgacgcagtgcgcg
gggatcgacatcggcatcttcgaccccgacctcgacccggacggcaagtacgcggccgag
ctcaccgacaccctcgtcgcagccctgacctga

DBGET integrated database retrieval system