KEGG   Kribbella flavida: Kfla_4953Help
Entry
Kfla_4953         CDS       T01155                                 

Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
kfl  Kribbella flavida
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Kfla_4953
Enzymes [BR:kfl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Kfla_4953
Exosome [BR:kfl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Kfla_4953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5344733..5347027
Genome map
AA seq 764 aa AA seqDB search
MGSSERGGEVRTPLSEAMTEPVNRPADEPNRQVGQAVGDARRPVPVDRAVLERLVAGTYH
DPHQVLGPHLGEGSVTLRVLRPFASTVTALFDGRRVELEHEFEGIWVGVLEVDKVPDYRL
EVTYTDGPAVELDDPYRYLPSLGEMDLHLIGEGRHEQLWTVLGAHVRRYEGPGGVVTGTS
FAVWAPNAQGIRLTADFNFWDGRAHPLRTMGSSGVWELFVPGVGPGTRYKFDICGRDGVW
RQKADPMANFAETPPANASVVHESTYEWKDEAWLERRAAAQAHAEPMSVYEVHLGSWRKG
RSYRELADELVAYVNEMGFTHVELMPVMEHPFGGSWGYQVTSYFAPTSRFGDPDDFRFLV
DRLHQAGIGVLVDWVPAHFPKDAWALARFDGTPLYEHPDPRRGEQPDWGTLVFDFGRPQV
RNFLVANALYWAEEFHIDGLRVDAVASMLYLDYSRQEGQWVPNQYGGRENLEAVSFLQEM
NATLYKRVPGVITVAEESTSWPGVTRPTHLGGLGFGFKWNMGWMNDSLRYLEHEPIYRQY
HHSELTFSMMYAYSENFVLPLSHDEVVHGKGSLLRKMPGDRWQQLANLRAYLAMMWAHPG
KQLLFMGSEFGQESEWSEKGELDWWLLNHTDHQGLHRLVKDLNSVYKDTRALWGSDHLPE
RFSWIDANDAANNTFSFVRYGEQGEPTLACVVNFSAVPHHGYRLGLPYEGHWHEVVNTDA
DVYGGSGVGNLGGVTADGPGWHGMATSADISVPPLGAVWFRHDG
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgggatcgagcgagcgtggtggtgaggtgcggacgcccttgtcggaggcgatgaccgag
ccggtgaacaggccggccgacgagccgaaccgccaagtgggacaggccgtgggcgatgcg
cgacggccggttccggtcgaccgggcggtgctcgaacggctggtggccgggacctatcac
gatccgcaccaggtgctcggtccgcacctgggcgagggttcggtgacactgcgggtgctg
cggccgttcgcgagcacggtgaccgcgctgttcgacggccggcgggtcgagctggagcac
gagttcgagggcatctgggtcggcgtgctcgaggtcgacaaggtgcccgactaccggctc
gaggtgacctacaccgacgggcccgcggtcgagctcgacgacccgtaccgctacctgccc
tcgctcggtgagatggacctgcacctgatcggcgagggccggcacgagcagctgtggacc
gtgctcggtgcgcacgtgcggcgctacgaggggccgggcggcgtcgtcaccgggacgtcg
ttcgcggtctgggcgccgaacgcgcagggcatccggctgaccgccgacttcaacttctgg
gacggtcgcgcgcacccgctgcgcacgatggggtcgagcggcgtctgggagctgttcgtg
cccggcgtcgggccgggcacccggtacaagttcgacatctgcggccgggacggtgtctgg
cggcagaaggccgacccgatggccaacttcgccgagaccccgccggcgaacgcgtcggtc
gtgcacgagtcgacgtacgagtggaaggacgaggcctggctggagcggcgggccgcggcg
caggcgcacgccgagccgatgagcgtctacgaggtgcatctcggctcgtggcgcaagggc
cgctcgtaccgcgaactggccgacgagctcgttgcctacgtcaacgagatgggcttcacc
cacgtcgagctcatgccggtgatggagcacccgttcggcggctcctggggctaccaggtc
acctcgtacttcgccccgacctcgcggttcggcgatcccgacgacttccgcttcctggtc
gaccggctgcaccaggccggcatcggcgtgctggtcgactgggtgccggcgcacttcccg
aaggacgcctgggcgctggcccggttcgacggcaccccgctgtacgagcaccccgacccg
cggcgcggcgagcagcccgactggggcacgctggtcttcgacttcggccggccgcaggtg
cgcaacttcctggtcgcgaacgcgctgtactgggccgaggagttccacatcgacggcctg
cgggtcgacgcggtggcctcgatgctctacctggactactcgcgccaggaaggtcagtgg
gtgccgaaccagtacggcggccgggagaacctcgaggcggtgtcgttcctgcaggagatg
aacgccaccctctacaagcgggtgccgggcgtgatcacggtcgccgaggagtccacctcg
tggccgggtgtcacccggccgacccacctgggcgggctcggcttcggcttcaagtggaac
atgggctggatgaacgactcgctgcgctacctggagcacgagccgatctaccggcagtac
caccacagcgagctgacgttctcgatgatgtacgcctactccgagaacttcgtgctgccg
ctgtcgcacgacgaggtggtgcacggcaagggctcgctgctgcgcaagatgccgggcgac
cggtggcagcagctggcgaacctgcgcgcgtacctggcgatgatgtgggcacacccgggc
aagcagctgctgttcatgggcagcgagttcggccaggagtcggagtggtccgagaagggc
gagctcgactggtggctgctgaaccacaccgaccaccagggcctgcaccggctggtgaag
gacctcaacagcgtctacaaggacaccagggccctgtggggcagcgaccacctgccggag
cggttctcctggatcgacgccaacgacgccgccaacaacaccttctccttcgtccgctac
ggcgagcagggtgagccgacgctcgcctgcgtggtgaacttctccgccgtcccgcaccac
gggtaccggctcggcctgccgtacgagggccactggcacgaggtcgtcaacaccgacgcc
gacgtgtacggcgggtccggcgtcggcaacctgggcggcgtgaccgcggacggcccgggc
tggcacgggatggcgaccagcgcggacatctcggtgccgccgctcggcgcggtctggttc
cgccacgacggctga

DBGET integrated database retrieval system