KEGG   Kribbella flavida: Kfla_5264Help
Entry
Kfla_5264         CDS       T01155                                 

Definition
Ricin B lectin
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
kfl  Kribbella flavida
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:kfl00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:kfl00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5671832..5673730)
Genome map
AA seq 632 aa AA seqDB search
MPRTLRRHRPGRRRSLPVLAGFAALAVVAAGLSVGGPAPAYAAGEQVNVWLTTTNDAGGR
NVTRGLQQQTPISFGPAGGTAGHTVTVNENTTYQTFEGGGASFTDSAAWLLNSSNTISAT
TRNQVMKDLFDPVNGIGLAFTRNPMGASDLARFNYSYDDTCCDLNDFTINHDLADVVPLT
KQAKQLNPALKVKGAPWSAPAWMKDNNKFTNRGWLKWEHYPTYAQYFVKYVQQNEAAGNH
IDYVSVQNEPTCCGTDDTGYASMNWNGAGLLEFTKNHLLPAFRAAGITTKVMILDYNWGN
YDDLGSVPLADAALRNDPLFGGIAWHGYGGDVNLQTTVHNQYPAVNHYMTEHSGGTWIPN
QQVEDMNNLIDYTRNWSKSWVKWSLALDQNMLPYVGAGCNVCTGLVTVQRGGPRAGQVDK
TIEYYTMGHLTKFVKPGAARIESTANTAVKNVAWKNPDGSKALIAFNTTGSSQSVRVNWG
SQSFVYTLPTKTSATFTWSGAQSGGGGTGGQITGLAGKCVDVAGANSADGTAVQLYDCNG
SAAQQWTRPGDGTVRALGKCLDVAGGGTADGSRVQLYTCNGSAAQQWNQTAGRDLVNPQA
NKCLDVTGSNSANATPLQIWSCTGAANQKWTV
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgcccaggacccttcgtcgtcaccgccccggacgacgacgttccctgcccgtactggcc
ggcttcgcggccctcgcggtcgtcgccgccggtctcagcgtcggcggcccggccccggcg
tacgccgcgggcgagcaggtcaacgtctggctgaccaccaccaacgatgccggtggccgc
aacgtcacccgcggcctgcagcagcagacgccgatcagcttcggccccgccggcggcacc
gccggccacaccgtcacggtcaacgagaacacgacgtaccagaccttcgagggcggcggt
gcgtcgttcaccgacagcgccgcctggctgctgaacagcagcaacacgatcagcgccacc
acccgcaaccaggtgatgaaggacctgttcgacccggtcaacgggatcggcctggccttc
acccgcaacccgatgggcgcctccgacctggcccggttcaactactcctacgacgacacc
tgctgcgacctgaacgacttcaccatcaaccacgacctggccgacgtcgtcccgctgacc
aagcaggccaagcagctgaacccggcgctgaaggtgaagggcgccccgtggagcgcaccg
gcctggatgaaggacaacaacaagttcaccaaccgcggctggctgaagtgggagcactac
ccgacgtacgcccagtacttcgtcaagtacgtgcagcagaacgaggctgccggcaaccac
atcgactacgtctcggtgcagaacgagccgacctgctgcggcaccgacgacaccggctac
gcctcgatgaactggaacggcgcgggcctgctcgagttcaccaagaaccacctgctgccg
gcgttccgggcggccggcatcaccacgaaggtgatgatcctggactacaactggggcaac
tacgacgacctcggctcggtcccgctggccgacgccgcgctgcgcaacgacccgctgttc
ggcgggatcgcgtggcacgggtacggcggtgacgtgaacctgcagaccaccgtgcacaac
cagtacccggccgtgaaccactacatgaccgagcactccggtggtacctggatcccgaac
cagcaggtcgaggacatgaacaacctgatcgactacacccgcaactggagcaagtcctgg
gtgaagtggagcctcgcgctggaccagaacatgcttccgtacgtcggtgccgggtgcaac
gtgtgcacgggactggtgacggtccagcggggtggtccgcgggccgggcaggtggacaag
acgatcgagtactacacgatgggccacctgacgaagttcgtgaagccgggtgcggcgcgg
atcgagtcgaccgcgaacaccgcggtcaagaacgtggcgtggaagaaccccgacggctcg
aaggcgctgatcgcgttcaacacgaccgggagctcgcagtcggtgcgggtgaactggggc
agccagtcgttcgtctacacgctgccgaccaagacctcggccaccttcacctggtcaggt
gcgcagagcggtggcggtgggaccggcggacagatcaccgggctggccggaaagtgcgtc
gatgttgcgggcgcgaactcggctgacggcacggcggtgcagctctacgactgcaacggc
agtgcggcacagcagtggacgcggcctggtgatgggacggtacgcgcgctcggcaagtgc
ctggatgtcgccggcggtggcacggctgacggttccagggtccagctctacacctgcaac
ggcagcgccgcccagcagtggaaccagaccgcgggaagggacctggtgaatccgcaggcc
aacaagtgcctcgacgtcaccggcagcaactccgccaatgccaccccgctgcagatctgg
agctgcaccggcgccgccaaccagaaatggaccgtctga

DBGET integrated database retrieval system