KEGG   Kribbella flavida: Kfla_5322Help
Entry
Kfla_5322         CDS       T01155                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
kfl  Kribbella flavida
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Kfla_5322
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Kfla_5322
Enzymes [BR:kfl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Kfla_5322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5736593..5737330)
Genome map
AA seq 245 aa AA seqDB search
MTTPRRALVTGAASGIGAACAQRLAADGMRVIAVDYDADGLQAVAGDGIEAVQADLADLE
RLADLPTDVDVLVNNAGVQLVAPVEQFPPERFGYILRLMLESPFRLIRQSLPHMYGRGWG
RVVNISSVHGLRASPFKSAYVAAKHGLEGLSKVVALEGAPHGVTSNCVNPAYVRTPLVTA
QLADQAALHGLTEAEVLDKILLEPVAVKRLIEPAEVAELVALLCGPASASLTGSSFVLDG
GWTAH
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccccacgtcgtgctctcgtcaccggcgccgcctccgggatcggcgcggcctgc
gcccagcggctcgccgccgacgggatgcgcgtgatcgcggtcgactacgacgccgacggt
ctgcaggccgttgccggcgacggcatcgaggcggtccaggccgacctggccgacctggag
cggctggccgacctgccgaccgacgtggacgtgctggtgaacaacgcaggcgtccagctg
gtcgctccggtcgagcagttcccgcccgagcggttcggctacatcctgcgactcatgctg
gagtcgccgttccggctcatccggcagtcgctgccgcacatgtacggccggggctggggc
cgggtggtcaacatcagctcggtgcacggactgcgcgccagcccgttcaagtcggcgtac
gtcgcggccaagcacgggctggaaggtctcagcaaggtggtcgcgctcgaaggcgcgcca
cacggcgtcaccagcaactgcgtgaacccggcgtacgtccggacgccgctcgtcaccgcc
cagctcgccgaccaggccgcgctgcacggcctgaccgaggcagaggtgctggacaagatc
ctgctcgaaccggtcgcggtcaagcggctgatcgagccggccgaggtcgccgagctggtc
gcgctgctctgcggcccggcctcggcctcactcacggggagctcgttcgtcctcgacggc
ggctggaccgcccattaa

DBGET integrated database retrieval system