KEGG   Kribbella flavida: Kfla_5487Help
Entry
Kfla_5487         CDS       T01155                                 

Definition
DeoR family transcriptional regulator
Orthology
K02081  
DeoR family transcriptional regulator, aga operon transcriptional repressor
Organism
kfl  Kribbella flavida
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5921405..5922187
Genome map
AA seq 260 aa AA seqDB search
MKRYERLNTLLESLAEKGAIDVDELAEQLHVSAATIRRDLDHLGKQQLLTRTRGGAVANA
VSYDLPLRYKTARFASEKQRIAQAAATLVRRGMVIGMNGGTTISEVARTLATRPELSAEH
GEPAFTLVTNALNIANELIVRPHVKMVLTGGVARPQSYEMIGPLSHRILADLSLDIAFIG
VDGIDETGATAHHEGEANINQLIVSRASKVVVVADSSKLGQRAFARICELSEIDTLVTDA
QADESQLAVFKEAGVDVIRS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcgttatgaacggctgaacacgctgctcgagtcgctggccgagaagggcgcgatc
gacgtcgacgagctcgccgagcagctgcacgtgtccgccgcgaccatccgccgcgacctc
gaccacctgggcaagcagcagctcctcacccggacccgcggcggcgcggtcgcgaacgcg
gtttcctacgacctgccgttgcgctacaaaactgcgcgtttcgcgtcggagaagcaacgg
atcgcgcaggccgcggccactctggtccgccgcggcatggtgatcgggatgaacggcggc
accacgatctccgaggtggcgcgcacgctggcgacccggccggagctgtccgccgagcac
ggcgagccggccttcacgctcgtcaccaacgccctgaacatcgccaacgagctgatcgtc
cgcccgcacgtgaagatggtgctcaccggcggcgtggcccggccgcagtcgtacgagatg
atcgggccgctgtcgcaccggatcctggccgacctgtcgctggacatcgccttcatcggc
gtcgacggcatcgacgagaccggcgccaccgcccaccacgagggcgaggcgaacatcaac
cagctgatcgtcagccgggcgtccaaggtcgtcgtggtggccgactcgtccaagctcggc
cagcgcgcgttcgcccggatctgcgagctcagcgagatcgacaccctggtcaccgacgcg
caggccgacgagtcccagctggccgtcttcaaggaagccggcgtcgacgtcatccgttcg
tag

DBGET integrated database retrieval system