KEGG   Kribbella flavida: Kfla_5487Help
Entry
Kfla_5487         CDS       T01155                                 

Definition
DeoR family transcriptional regulator
Orthology
K02081  
DeoR family transcriptional regulator, aga operon transcriptional repressor
Organism
kfl  Kribbella flavida
Brite
Transcription factors [BR:kfl03000]
 Prokaryotic Type
  Helix-turn-helix
   DeoR family
    Kfla_5487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5921405..5922187
Genome map
AA seq 260 aa AA seqDB search
MKRYERLNTLLESLAEKGAIDVDELAEQLHVSAATIRRDLDHLGKQQLLTRTRGGAVANA
VSYDLPLRYKTARFASEKQRIAQAAATLVRRGMVIGMNGGTTISEVARTLATRPELSAEH
GEPAFTLVTNALNIANELIVRPHVKMVLTGGVARPQSYEMIGPLSHRILADLSLDIAFIG
VDGIDETGATAHHEGEANINQLIVSRASKVVVVADSSKLGQRAFARICELSEIDTLVTDA
QADESQLAVFKEAGVDVIRS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcgttatgaacggctgaacacgctgctcgagtcgctggccgagaagggcgcgatc
gacgtcgacgagctcgccgagcagctgcacgtgtccgccgcgaccatccgccgcgacctc
gaccacctgggcaagcagcagctcctcacccggacccgcggcggcgcggtcgcgaacgcg
gtttcctacgacctgccgttgcgctacaaaactgcgcgtttcgcgtcggagaagcaacgg
atcgcgcaggccgcggccactctggtccgccgcggcatggtgatcgggatgaacggcggc
accacgatctccgaggtggcgcgcacgctggcgacccggccggagctgtccgccgagcac
ggcgagccggccttcacgctcgtcaccaacgccctgaacatcgccaacgagctgatcgtc
cgcccgcacgtgaagatggtgctcaccggcggcgtggcccggccgcagtcgtacgagatg
atcgggccgctgtcgcaccggatcctggccgacctgtcgctggacatcgccttcatcggc
gtcgacggcatcgacgagaccggcgccaccgcccaccacgagggcgaggcgaacatcaac
cagctgatcgtcagccgggcgtccaaggtcgtcgtggtggccgactcgtccaagctcggc
cagcgcgcgttcgcccggatctgcgagctcagcgagatcgacaccctggtcaccgacgcg
caggccgacgagtcccagctggccgtcttcaaggaagccggcgtcgacgtcatccgttcg
tag

DBGET integrated database retrieval system