KEGG   Kribbella flavida: Kfla_5517Help
Entry
Kfla_5517         CDS       T01155                                 

Definition
(GenBank) PfkB domain protein
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
kfl  Kribbella flavida
Pathway
kfl00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Kfla_5517
Enzymes [BR:kfl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Kfla_5517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase
Motif
Other DBs
NCBI-ProteinID: ADB34526
UniProt: D2PN42
Position
5950135..5951154
Genome map
AA seq 339 aa AA seqDB search
MTGPMPRLRRTRYDVCVLGSFMKDLVASADRRPLPGETLHGTAFAEFLGGKGVNQAIAAA
RMGARTAIVGTIGADRYGEEFLDLLTTDGVDTGWVVRHPELGTGVGLPLVLPDGSNSIII
VSRANAAITPADIEAAGEVLTGSRVLSVQLELPVEASRAALRLASAAGVTTILTPAPVGP
VDASLTEYVDILVPNEVEAAALTGLDCDDESQVPAIARKLADEWDLRGCVVTLGSRGAFV
LDRTAGVELRVAPHRVATVDTVGAGDAFCGSLAASLAEGAPLTDAVRLANAAGALSTTVN
GAAASAPGRAEAEDLLGSVLVGGAPETEASPLAVAPPNP
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaccggaccgatgccgcgcctccggcgtacccggtacgacgtgtgcgtgctcggctcg
ttcatgaaggacctggtcgccagcgcggaccggcggccgctgcccggggagaccctgcac
ggcacggcgttcgcggagttcctcggcggcaagggcgtgaaccaggcgatcgccgcggcc
cggatgggcgcccggaccgccatcgtcggaaccatcggcgccgaccggtacggcgaggag
ttcctggacctgctgaccaccgacggcgtcgacaccggctgggtggtccggcaccccgag
ctcgggaccggcgtcgggctgccgctggtcctgccggacggcagcaactcgatcatcatc
gtgtcccgcgcgaacgcggcgatcaccccggccgacatcgaggcggccggcgaggtgctg
accggcagccgggtgctgagcgtccagctcgaactcccggtcgaggcgagccgggctgcc
ctccggctcgcctcggccgcgggcgtcaccacgatcctcacccccgcgccggtcgggccg
gtggacgcgtcgctgacggagtacgtcgacatcctggtcccgaacgaggtcgaggccgcc
gcgctgaccggactcgactgcgacgacgagtcgcaggtcccggcgatcgcgcgcaagctg
gccgacgagtgggacctgcgcggctgcgtggtgacgctcggttcgcggggagcgttcgtg
ctggaccggaccgcgggcgtcgagctgcgggtcgcgccgcaccgcgtcgcgacggtcgac
accgtcggggccggcgacgccttctgcggatcgctcgcggcctccctggcggagggcgcg
ccgctgacggacgcggtacgcctggcgaacgcggcgggcgccctgtcgaccaccgtcaac
ggcgccgccgcctccgctcccgggcgggccgaggccgaggatctgctgggctccgtcctg
gtcgggggcgccccggaaacagaagcgtcaccactcgccgtcgcaccgcccaacccgtga

DBGET integrated database retrieval system