KEGG   Kribbella flavida: Kfla_5713Help
Entry
Kfla_5713         CDS       T01155                                 

Definition
Stearoyl-CoA 9-desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
kfl  Kribbella flavida
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:kfl01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:kfl01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6144901..6145977)
Genome map
AA seq 358 aa AA seqDB search
MTSSAVAAPETPDRADQSGDLAEPAAGAGAQAGVETGTMGGEQKNFGEQLALGLFIGIPF
LAVLAAVPVAWGGFLGWRDVVIAVVFYTVSGHGISIGFHRLFTHKSFKPNRPLKIALLVA
GSLAIEGPVVRWVADHRKHHKFSDRDGDPHSPWKYGTSVRALTKGFLHAHIGWLFDTEQT
PQRQYAPDLLKDKDIVKVSRMFPALVLVSLLLPAVIGGLWSWSIEGALTAFFWASLVRIA
LLHHVTWSINSICHTIGARPFKSRDKSGNVWWLAILSQGESWHNLHHSDPTCARHGVLKG
QLDTSARCIWFFEKMGWVSDVRWPVPERLEARRVSAAEQATAKAAGRAARSGRDRAAA
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgacttcatccgccgtggccgcaccggaaacgccggaccgcgccgaccagtccggagac
ctcgccgagccggctgccggggccggtgcccaggccggtgtcgagaccggcacgatgggc
ggcgagcagaagaacttcggcgagcagctcgcgctcgggttgttcatcgggatcccgttc
ctggctgtgctggccgccgtgccggttgcctggggagggttcctgggctggcgcgacgtc
gtgatcgcggtggtgttctacaccgtctccgggcacggcatctcgatcggtttccaccgg
ctgttcacgcacaagtcgttcaagccgaaccggccgctgaagatcgcgttgctggtggcc
ggctcgctggcgatcgaggggccggtggtgcgctgggtcgccgaccaccgcaagcaccac
aagttctccgaccgcgacggcgacccgcacagcccgtggaagtacggcaccagcgtgcgc
gcgctgaccaagggtttcctgcacgcgcacatcggctggttgttcgacaccgagcagacc
ccgcagcggcagtacgcgccggacctgctgaaggacaaggacatcgtcaaggtgtcccgg
atgttcccggcgctggtcctggtctcgctgctgctgccggccgtcatcggcgggctgtgg
tcgtggtcgatcgagggcgcgctgaccgcgttcttctgggccagcctggtccggatcgcg
ctgctgcaccacgtcacctggtcgatcaactcgatctgccacacgatcggcgcccggccg
ttcaagagccgggacaagtcgggcaacgtctggtggctggcgatcctgagccagggcgag
tcctggcacaacctgcaccactccgacccgacctgcgcgcggcacggcgtcctgaagggc
cagctcgacacctcggcccggtgcatctggttcttcgagaagatgggctgggtcagcgac
gtccgctggccggtgccggagcgtctcgaggcccgccgggtgagcgccgccgagcaggcc
accgccaaggccgccgggcgggccgcccgctccggccgcgaccgggccgcggcctga

DBGET integrated database retrieval system