KEGG   Kribbella flavida: Kfla_5768Help
Entry
Kfla_5768         CDS       T01155                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
kfl  Kribbella flavida
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Kfla_5768
   00052 Galactose metabolism
    Kfla_5768
   00500 Starch and sucrose metabolism
    Kfla_5768
   00520 Amino sugar and nucleotide sugar metabolism
    Kfla_5768
Enzymes [BR:kfl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Kfla_5768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6205325..6206713)
Genome map
AA seq 462 aa AA seqDB search
MSEAGLQQAQDKMRAAGAAEVAIRVFSHYYRLLEAGQQGTIRESEIEPVGELPQLDRLDT
DTESMRAALAETVVIKLNGGLGTSMGVTGPKSALPVKDGLSFLDIIARQILSTRKTYDVP
LPLVLMNSFRTRDESLAVLNQYADLPVDGLPLDFQQNMEPKLLAEDLTPVEWPDDPELAW
CPPGHGDLFTALVASGTLDALREHGFRHAFISNADNLGATPDGRIAAWMAEHDVPFGMEV
CRRTRSDRKGGHVAVRTSDGRLILRDSAQVHADDTASFQDITRHKTFNTNNLWIDLDRLA
DLMAGHDGVLGLPIIVNHKTVDPADPDSPKVIQLETGMGTAIETFEGSQAVLVDRSRFKP
VKTTNDLLVLRSDVYDLDEAGDLTTTHEGDEPYVDLDPDHFKILADFEARFPAGPPSLVR
ADRLEVRGDVAFGKDVVVVGEVEVTAPEGERLQIADGTELRG
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaggcgggtcttcagcaggcacaggacaagatgcgggcggccggcgcggccgag
gtcgcgatcagggtcttctcgcactactaccggttgctcgaggcgggacagcagggcacg
atccgcgagagcgagatcgagccggtcggtgagctgccgcagctggaccgcctggacacc
gacaccgagtcgatgcgggccgcgctcgcggagaccgtggtgatcaagctgaacggcggc
ctcggcacgtcgatgggcgtcaccggcccgaagtccgcgctgccggtgaaggacgggctg
agcttcctcgacatcatcgcccggcagatcctcagcacccgcaagacgtacgacgtaccg
ctgccgctggtgctgatgaactccttccggacccgggacgagtccctggcggtgctcaac
cagtacgccgacctgccggtcgacgggctgccgctggacttccagcagaacatggagccc
aagctgctcgccgaggacctcaccccggtggagtggcccgacgaccccgagctggcctgg
tgcccgccgggtcacggcgacctgttcaccgcgctggtcgcctccggcacgctggacgcg
ctgcgcgagcacggcttccggcacgccttcatctcgaacgccgacaacctcggcgccacg
ccggacggccggatcgcggcctggatggccgagcacgacgtgccgttcgggatggaggtg
tgccgccggacccgctcggaccgcaagggcgggcacgtcgcggtgcgcacgtccgacggc
cggctgatcctgcgcgacagcgcccaggtgcacgccgacgacactgcgtcgttccaggac
atcacccggcacaagacgttcaacaccaacaacctgtggatcgatctggaccggctggcc
gacctgatggccggccacgacggcgtgctcggcctgccgatcatcgtcaaccacaagacc
gtcgacccggccgacccggactcgccgaaggtgatccagctggagaccggcatgggcacc
gcgatcgagaccttcgagggatcgcaggctgtcctggtggaccgcagccggttcaagccg
gtgaagacgaccaacgacctgctggtgctgcgctcggacgtctacgacctggacgaggcc
ggcgacctgaccaccacgcacgagggcgacgagccgtacgtcgacctggaccccgaccac
ttcaagatcctggccgacttcgaggcgcggttcccggccgggccgccgtcgctggtccgc
gccgaccggctggaggtgcgcggcgacgttgccttcggcaaggacgtggtggtggtcggc
gaggtcgaggtgaccgcgcccgagggcgagcggctgcagatcgccgacggcaccgagctg
cgcggctga

DBGET integrated database retrieval system