KEGG   Kribbella flavida: Kfla_6020Help
Entry
Kfla_6020         CDS       T01155                                 

Definition
glucose-methanol-choline oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
kfl  Kribbella flavida
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Kfla_6020
Enzymes [BR:kfl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Kfla_6020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6463483..6465195)
Genome map
AA seq 570 aa AA seqDB search
MRFDHDVVIIGSGFGGSVSALRLVEKGYRVAVLEAGARFEDAGFAKNSWDKNRFLFAPKL
GWYGIQRISALRDVIILSGAGVGGGSLVYANTLYEPLPAFYADRQWAHITDWKSELAPYY
DQAKRMLGVTTYPHFSPADKVMKQVADDMGVGDTFHPTPVGIFFGEPGVEVDDPYFGGVG
PRRSGCIDCGECMTGCRHNAKNTLTKNYLYLAEQAGAEVYPMTTVTSVEPLSGGGYLIET
RGTSNRKKVRRFTAEQVVFAASALGTAKLLHRLRDEGKLPRLSDRLGVLTRTNSESLLGA
IALNRDVDYSRGVAITSSFHPDEITHIEPVRYGKGSNAMSLLQTVLTDGDGDIPRWRTWL
RELGVQRKNIRRLYDLKHWSERTVIALVMQTEDNSITTFGRRDRVGRWRLTSKQGHGAPN
PSWIPVANEVVRRMAKVMGGTPGGTIGEPFNVPMTAHFIGGCAIGDSAETGVVDAYHRVY
GYAGLHIMDGSTISANLGVNPSLTITAQAERALAFWPNKGEADPRPAPGTPYRRVAPVQP
ARPVVPVNAPGALRLPIVQITSAQHPVTKS
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttcgaccacgacgtggtgatcatcgggtccggcttcggcggcagcgtcagcgcc
ctgcggctggtcgagaagggctaccgggtcgcggtcctggaagcgggtgcccggttcgag
gacgccgggttcgcgaagaactcgtgggacaagaaccggttcctgttcgcgccgaagctc
ggctggtacggcatccagcggatcagcgccctgcgcgacgtgatcatcctgtccggcgcg
ggcgtcggcggcggcagcctggtctacgccaacaccctgtacgagccgctgccggccttc
tacgccgaccggcagtgggcccacatcaccgactggaagagcgagctggcgccgtactac
gaccaggcgaagcgcatgctcggcgtgacgacgtacccgcacttcagcccggccgacaag
gtgatgaagcaggtcgccgacgacatgggcgtgggcgacacgttccaccccaccccggtc
ggcatcttcttcggcgagccgggggtcgaggtcgacgacccgtacttcggcggcgtcggg
ccgcggcgcagcgggtgcatcgactgcggcgagtgcatgaccggctgccggcacaacgcg
aagaacaccctgaccaagaactacctctacctggccgagcaggccggcgcggaggtgtac
ccgatgacgacggtgacctcggtcgagccgctgtccggcggcggctacctgatcgagacc
cgggggacgtcgaaccggaagaaggtccgccggttcaccgcggaacaggtcgttttcgcc
gcctccgcgctcggtacggccaagttgctgcaccggctccgcgacgagggcaagctgccg
aggctgtcggaccggctgggcgtgctgacccggaccaactccgagtcgttgctgggcgcg
atcgcgctgaaccgcgacgtcgactacagccgcggggtggcgatcacgtcgtcgttccac
cccgacgagatcactcacatcgagccggtccggtacggcaagggcagcaacgcgatgtcg
ctgctgcagaccgtgctgaccgacggcgacggcgacatcccgcgctggcggacctggctg
cgggaactgggggtgcagcgcaagaacatccgccggctgtacgacctgaagcactggtcg
gagcgcacggtgatcgcgctggtgatgcagaccgaggacaactcgatcaccaccttcggc
cggcgggaccgggtcggccgctggcggctcacctcgaagcagggccacggtgcccccaac
ccgtcctggatcccggtcgcgaacgaggtggtccggcggatggccaaggtgatgggtggc
acgcccggcggcaccatcggggagccgttcaacgtgccgatgaccgcgcacttcatcggg
ggctgcgcgatcggcgactccgccgagaccggcgtcgtcgacgcgtaccaccgggtctac
gggtacgcgggcctgcacatcatggacggctcgacgatctcggcgaacctgggcgtcaac
ccgtcgctgacgatcaccgcacaggccgagcgggcgctggcgttctggccgaacaagggc
gaggccgatccgcggccggcccccggtacgccgtaccggcgggtggcgccggtgcagccc
gcgcggccggtcgtcccggtgaatgcgcccggggcgctgcggctgcccattgtgcagatc
accagcgcgcagcatcctgtgacgaaatcgtga

DBGET integrated database retrieval system